DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98a and Or19a

DIOPT Version :9

Sequence 1:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster


Alignment Length:391 Identity:94/391 - (24%)
Similarity:163/391 - (41%) Gaps:64/391 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 MGWHTP------ATHKIIYYITSCLIFAWCAVYLPIGIIISFKTDINTFTPNELLTVMQLFFNSV 89
            ||.|.|      ..|...|.:...:.|..|       |.:||  .:|....|.|.|..:..  .|
  Fly    22 MGIHPPGKRTFWGRHYTAYSMVWNVTFHIC-------IWVSF--SVNLLQSNSLETFCESL--CV 75

  Fly    90 GMPFKVLFFNL---------YISGFYKAKKLLSEMDKRCTTLKERVEVHQGVVRCNKAYLIYQFI 145
            .||..:....|         .||..:    ||..:|||.....||..:..|:.|   |..|::.|
  Fly    76 TMPHTLYMLKLINVRRMRGQMISSHW----LLRLLDKRLGCDDERQIIMAGIER---AEFIFRTI 133

  Fly   146 YTAYTIST-----FLSAALSGKLPWRIYNPFVDFRESRSSFWKAALNETALMLFAVTQTLMSDIY 205
            :.....:.     ::||:....|.:..:.|: ::|:|.|::...|:..|..::...|..|....|
  Fly   134 FRGLACTVVLGIIYISASSEPTLMYPTWIPW-NWRDSTSAYLATAMLHTTALMANATLVLNLSSY 197

  Fly   206 PLLYGLILRVHLKLLRLRVESLCTDSGKSDAENEQDLIKCIKDHNLIIDYAAAIRPAVTRTIFVQ 270
            |..|.:::.||.|.|.|||..|...:.......:..|:..|.||.:|:....::..:::.|.|:|
  Fly   198 PGTYLILVSVHTKALALRVSKLGYGAPLPAVRMQAILVGYIHDHQIILRLFKSLERSLSMTCFLQ 262

  Fly   271 -------------FLLIGICLGLSMINLLFFADIWTGLATVAYINGLMVQTFPFCFVCDLLKKDC 322
                         |||.|....:..:|:||...|            |..:|...|:..:|..|:.
  Fly   263 FFSTACAQCTICYFLLFGNVGIMRFMNMLFLLVI------------LTTETLLLCYTAELPCKEG 315

  Fly   323 ELLVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIAFTAGSIFPISTGSNIKVAKLAFSVVTFVNQ 387
            |.|::|::..||::.|.:::..|...|...|..:...:|.|.|||..:...:.|.|::::|.:|:
  Fly   316 ESLLTAVYSCNWLSQSVNFRRLLLLMLARCQIPMILVSGVIVPISMKTFTVMIKGAYTMLTLLNE 380

  Fly   388 L 388
            :
  Fly   381 I 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 79/331 (24%)
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 78/328 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468628
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.