DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98a and Or94b

DIOPT Version :9

Sequence 1:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster


Alignment Length:391 Identity:76/391 - (19%)
Similarity:165/391 - (42%) Gaps:43/391 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TNLLTSPDSFRYFEYGMFCMGWHTPATHKIIYYITSCLIFAWCAVYLPIG---IIISFKTDINTF 73
            ||.|::..:....:..:..:.|.......::.::.....|   .::||:.   |.:.:...|.:.
  Fly     4 TNRLSAIQTLLVIQRWIGLLKWENEGEDGVLTWLKRIYPF---VLHLPLTFTYIALMWYEAITSS 65

  Fly    74 TPNELLTVMQLFFNSVGMPFKVLFFNLYISGFYKAKKLLSEMD-KRCTTLK--ERVEVHQGVVRC 135
            ...|...|:.:....:.:..|:|  |::... ::|..|:.|:. .....|:  |.::..|...| 
  Fly    66 DFEEAGQVLYMSITELALVTKLL--NIWYRR-HEAASLIHELQHDPAFNLRNSEEIKFWQQNQR- 126

  Fly   136 NKAYLIYQFIYTAYTIST--FLSAALSG--KLPWRIYNPFVDFRESRSSFWKAALNETALMLFAV 196
            |...:.|.:|:.:..::.  ::|.....  :||:..|.|| ::|.....|:....|..|:.|..:
  Fly   127 NFKRIFYWYIWGSLFVAVMGYISVFFQEDYELPFGYYVPF-EWRTRERYFYAWGYNVVAMTLCCL 190

  Fly   197 TQTLMSDIYPLLYGLILRVHL----KLLRLRVESLCTDSGKSDAENE--QDLIKCIKDH----NL 251
            :..|:..:     |.....|:    :||.:|:|:|     |:.||.:  .:|.:..:.|    .|
  Fly   191 SNILLDTL-----GCYFMFHIASLFRLLGMRLEAL-----KNAAEEKARPELRRIFQLHTKVRRL 245

  Fly   252 IIDYAAAIRPAV-TRTIFVQFLLIGICL-GLSMINLLFFADIWTGLATVAYINGLMVQTFPFCFV 314
            ..:....:.|.| ::.:|..|:   ||. ...::::.|.......:.||.::..::||.|..|:.
  Fly   246 TRECEVLVSPYVLSQVVFSAFI---ICFSAYRLVHMGFKQRPGLFVTTVQFVAVMIVQIFLPCYY 307

  Fly   315 CDLLKKDCELLVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIAFTAGSIFPISTGSNIKVAKLAF 379
            .:.|......|.:::|.:||:..|...:..|..:::..::.:...||..|.|.....:|....|:
  Fly   308 GNELTFHANALTNSVFGTNWLEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIGLPIFVKTINNAY 372

  Fly   380 S 380
            |
  Fly   373 S 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 65/323 (20%)
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 65/323 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466096
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.