DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98a and Or92a

DIOPT Version :9

Sequence 1:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524414.2 Gene:Or92a / 42425 FlyBaseID:FBgn0038798 Length:408 Species:Drosophila melanogaster


Alignment Length:368 Identity:67/368 - (18%)
Similarity:135/368 - (36%) Gaps:91/368 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ITSCLIFAWCAVYLPIGIIISFK------TDINTFTPNELLTVMQLFFNSVGMPFKVLFFNLYIS 103
            :..|:.|::.|.:...|:.::.|      .|:....|.:|         .....:.|.|:..:::
  Fly    87 VAPCIGFSFMADFKQFGLTVNRKRLVRLLDDLKEIFPLDL---------EAQRKYNVSFYRKHMN 142

  Fly   104 GFYKAKKLLSEMDKRCTTLKERVEVHQGVVRCNKAYLI--------YQF-IYTAYTISTFLSAAL 159
                  ::::.....|.|.......:..:....|.||:        |.| |...|...|.|:   
  Fly   143 ------RVMTLFTILCMTYTSSFSFYPAIKSTIKYYLMGSEIFERNYGFHILFPYDAETDLT--- 198

  Fly   160 SGKLPWRIYNPFVDFRESRSSFWKAA----------LNETALMLFAVTQTLMSDIYPLLYGLILR 214
               :.|             .|:|..|          :....|::..:||              |.
  Fly   199 ---VYW-------------FSYWGLAHCAYVAGVSYVCVDLLLIATITQ--------------LT 233

  Fly   215 VHLKLLRLRVESLCTDSG-KSDAENEQDLIKCIKDHNLIIDYAAAIRPAVTRTIFVQFLLIGICL 278
            :|...:...:|:.  :.| .:|.||    ||.:  |||::.:|.|:..:........||::...:
  Fly   234 MHFNFIANDLEAY--EGGDHTDEEN----IKYL--HNLVVYHARALDLSEEVNNIFSFLILWNFI 290

  Fly   279 GLSMINLLFFADIWTGLATV-------AYINGLMVQTFPFCFVCDLLKKDCELLVSAIFHSNWIN 336
            ..|::  :.||......:.|       .:.:..:||.|..|:..|.:......:..:.|:.||:.
  Fly   291 AASLV--ICFAGFQITASNVEDIVLYFIFFSASLVQVFVVCYYGDEMISSSSRIGHSAFNQNWLP 353

  Fly   337 SSRSYKSSLRYFLKNAQKSIAFTAGSIFPISTGSNIKVAKLAF 379
            .|..||..|::.:..:||..:....:..|||..:.:||..:::
  Fly   354 CSTKYKRILQFIIARSQKPASIRPPTFPPISFNTFMKVISMSY 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 61/331 (18%)
Or92aNP_524414.2 7tm_6 80..396 CDD:251636 67/366 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465988
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.