DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98a and Or88a

DIOPT Version :9

Sequence 1:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster


Alignment Length:455 Identity:83/455 - (18%)
Similarity:143/455 - (31%) Gaps:158/455 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FNYLRKPNPTNLLTS---PDSFRYFEYGMF--CMGW--------------HTPATHKIIYYITSC 48
            |.:.|.|...:::.:   |.....|...:|  |.||              :.|.....||:....
  Fly    30 FQWRRNPVDNSMVNASMVPFCLSAFLNVLFFGCNGWDIIGHFWLGHPANQNPPVLSITIYFSIRG 94

  Fly    49 LIFAWCAVYLPIGIIISFKTDINTFTPNELLTVMQLFFNSVGMPFKVLFFNLYISGFYKAKKLLS 113
            |:     :||....|:.|..|::...|.:|::.:.:                             
  Fly    95 LM-----LYLKRKEIVEFVNDLDRECPRDLVSQLDM----------------------------- 125

  Fly   114 EMDKRCTTLKERVEVHQGVVRCNKAYLIYQFIYTAYTISTFLSAALSGKLPWRIYNPFVDFRESR 178
            :||:......:|                |:||                    |||          
  Fly   126 QMDETYRNFWQR----------------YRFI--------------------RIY---------- 144

  Fly   179 SSFWKAALNETALMLFAVT-----------QTLMSDIYPLLYGLILRVHLKLLRLRVESLCTDSG 232
            |...........|.||.:|           :.|:....|.  |:....:..||....:.:||..|
  Fly   145 SHLGGPMFCVVPLALFLLTHEGKDTPVAQHEQLLGGWLPC--GVRKDPNFYLLVWSFDLMCTTCG 207

  Fly   233 KSDAENEQDLIKCIKDHNLIIDYA------AAIRPAVTRT----IFV--------QFLLIGICLG 279
            .|......:|...::.| |::...      :||.|..:.|    .||        |.||.|:|..
  Fly   208 VSFFVTFDNLFNVMQGH-LVMHLGHLARQFSAIDPRQSLTDEKRFFVDLRLLVQRQQLLNGLCRK 271

  Fly   280 LSMI--------------NLLFF-------ADIWTGLATVAYINGLMVQ---TFPFCFVCDLLKK 320
            .:.|              :|.|:       :|:   |....||...:|.   ||..|.....|:|
  Fly   272 YNDIFKVAFLVSNFVGAGSLCFYLFMLSETSDV---LIIAQYILPTLVLVGFTFEICLRGTQLEK 333

  Fly   321 DCELLVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIAFTAGSIFPISTGSNIKVAKLAFSVVTFV 385
            ..|.|.|::....|...||.|:.....:.:..|::....|..:..::.....::.:||:.:.||:
  Fly   334 ASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRTQQLGAFGLIQVNMVHFTEIMQLAYRLFTFL 398

  Fly   386  385
              Fly   399  398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 62/357 (17%)
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 71/402 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465996
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.