DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98a and Or85e

DIOPT Version :9

Sequence 1:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster


Alignment Length:414 Identity:72/414 - (17%)
Similarity:148/414 - (35%) Gaps:97/414 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 AWCAVY----LPIGIIISFKTDINTFTPNELLTVMQLFFNSVGMPFKVLFFNLYISGFY--KAKK 110
            |:|::.    |.:|::.: ||.::.....||..:......::     :.||..|.:.::  ::::
  Fly    65 AYCSMVIFTSLHLGVLFT-KTTLDVLPTGELQAITDALTMTI-----IYFFTGYGTIYWCLRSRR 123

  Fly   111 LLSEMDKRCTTLKERVEVHQGVVRCNKAYLIYQFIYTAYTIS-----TFLSAALSGKLPWRIYNP 170
            ||:.|:.     ..|...|..:     |.:.:...:.|:.:|     .::.:.|.|.:.|.:...
  Fly   124 LLAYMEH-----MNREYRHHSL-----AGVTFVSSHAAFRMSRNFTVVWIMSCLLGVISWGVSPL 178

  Fly   171 FVDFRESRSSFW----------KAALNETALM--------------LFAVTQTLMSDIYPLLY-- 209
            .:..|......|          ..|:..|.|.              ||.....|:...:.:||  
  Fly   179 MLGIRMLPLQCWYPFDALGPGTYTAVYATQLFGQIMVGMTFGFGGSLFVTLSLLLLGQFDVLYCS 243

  Fly   210 -----------------GL--------------------ILRVH-LKLLRLRVESLCTDSGKSDA 236
                             ||                    :|:.| ..||||.....|.|.|.:  
  Fly   244 LKNLDAHTKLLGGESVNGLSSLQEELLLGDSKRELNQYVLLQEHPTDLLRLSAGRKCPDQGNA-- 306

  Fly   237 ENEQDLIKCIKDHNLIIDYAAAIRPAVTRTIFVQFLLI--GICLGLSMINLLFFADIWTGLATVA 299
             ....|::||:.|..|:..:..:....:....|:.|.|  .:|| |..:.:....::...:..:.
  Fly   307 -FHNALVECIRLHRFILHCSQELENLFSPYCLVKSLQITFQLCL-LVFVGVSGTREVLRIVNQLQ 369

  Fly   300 YINGLMVQTFPFCFVCDLLKKDCELLVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIAFTAGSIF 364
            |:...:.:...|.:..:||.:.......|.:...|...:...:..:..||.|:::::..|||..:
  Fly   370 YLGLTIFELLMFTYCGELLSRHSIRSGDAFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKFY 434

  Fly   365 PISTGSNIKVAKLAFSVVTFVNQL 388
            .:.......|...|||.:|.:.:|
  Fly   435 VMDVNRLRSVITQAFSFLTLLQKL 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 61/377 (16%)
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 56/342 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.