DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98a and Or85a

DIOPT Version :9

Sequence 1:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster


Alignment Length:402 Identity:146/402 - (36%)
Similarity:242/402 - (60%) Gaps:12/402 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLFNYLRKPNPTNLLTSPDSFRYFEYGMFCMGWHTPATHK---IIYYITSCLIFAWCAVYLPIGI 62
            |:|.|:::|...:|..|.||..|....:..|||..|...|   .:|||.:.::.....:::|.|:
  Fly     1 MIFKYIQEPVLGSLFRSRDSLIYLNRSIDQMGWRLPPRTKPYWWLYYIWTLVVIVLVFIFIPYGL 65

  Fly    63 IISFKTDINTFTPNELLTVMQLFFNSVGMPFK---VLFFNLYISGFYKAKKLLSEMDKRCTTLKE 124
            |::...:...||..:|.|.:|:..|:.....|   |||..   ..|.:|:|::..||.|||.::|
  Fly    66 IMTGIKEFKNFTTTDLFTYVQVPVNTNASIMKGIIVLFMR---RRFSRAQKMMDAMDIRCTKMEE 127

  Fly   125 RVEVHQGVVRCNKAYLIYQFIYTAYTISTFLSAALSGKLPWRIYNPFVDFRESRSSFWKAALNET 189
            :|:||:....||:..:||..||..|.......|.:.||.|:.:|||.|:   ....|:.|...|:
  Fly   128 KVQVHRAAALCNRVVVIYHCIYFGYLSMALTGALVIGKTPFCLYNPLVN---PDDHFYLATAIES 189

  Fly   190 ALMLFAVTQTLMSDIYPLLYGLILRVHLKLLRLRVESLCTDSGKSDAENEQDLIKCIKDHNLIID 254
            ..|...:...|:.|:||::|.::||:|::||..|:::|.||..|.|.::..:|::|:|||.||::
  Fly   190 VTMAGIILANLILDVYPIIYVVVLRIHMELLSERIKTLRTDVEKGDDQHYAELVECVKDHKLIVE 254

  Fly   255 YAAAIRPAVTRTIFVQFLLIGICLGLSMINLLFFADIWTGLATVAYINGLMVQTFPFCFVCDLLK 319
            |...:||.::.|:|:|.|.:|:.|||:.:::.|:..:...:.:..|...::.||||||:||:.|.
  Fly   255 YGNTLRPMISATMFIQLLSVGLLLGLAAVSMQFYNTVMERVVSGVYTIAILSQTFPFCYVCEQLS 319

  Fly   320 KDCELLVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIAFTAGSIFPISTGSNIKVAKLAFSVVTF 384
            .|||.|.:.:|||.||.:.|.|::::.||:.|.|:||.||||.||||...:|||:||.||||||.
  Fly   320 SDCESLTNTLFHSKWIGAERRYRTTMLYFIHNVQQSILFTAGGIFPICLNTNIKMAKFAFSVVTI 384

  Fly   385 VNQLNIADRLTK 396
            ||::::|::|.:
  Fly   385 VNEMDLAEKLRR 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 115/307 (37%)
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 115/307 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468538
Domainoid 1 1.000 64 1.000 Domainoid score I17159
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I7489
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D31412at7147
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.