DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98a and Or83c

DIOPT Version :9

Sequence 1:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524244.2 Gene:Or83c / 40744 FlyBaseID:FBgn0037399 Length:397 Species:Drosophila melanogaster


Alignment Length:353 Identity:67/353 - (18%)
Similarity:121/353 - (34%) Gaps:105/353 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IIYYITSCLIFAWCAV-YLPIGIIISFKTDINTFTPNELLTVMQLFFNSVGMPFKVLFFNLYISG 104
            |:..|.:..:||:|.: .||:.:::...|.:         |.||...  .|:|.:    |.|.  
  Fly   130 IMKIIRNGYVFAFCLMELLPLAMLMYDGTRV---------TAMQYLI--PGLPLE----NNYC-- 177

  Fly   105 FYKAKKLLSEMDKRCTTLKERVEVHQGVVRCNKAYLIYQFIYTAYT-ISTFLSAALSGKLPWRIY 168
                 .:::.|.:..|.|.:.|..:.|.:          |::...| |.|               
  Fly   178 -----YVVTYMIQTVTMLVQGVGFYSGDL----------FVFLGLTQILT--------------- 212

  Fly   169 NPFVDFRESRSSFWKAALNETALMLFAVTQTLMSDIYPLLYGLILRVHLKLLRLRVESLCTDSGK 233
              |.|..:.:......||.:.|                 .|..::||...:              
  Fly   213 --FADMLQVKVKELNDALEQKA-----------------EYRALVRVGASI-------------- 244

  Fly   234 SDAENEQD-LIKCIKDHNLIIDYAAAIRPAVTRTIFVQFL------LIGICLGLS---MINLLFF 288
            ..|||.|. |:..|:.|.|..||..||.......|..|.|      ::..|:.||   |.:.:||
  Fly   245 DGAENRQRLLLDVIRWHQLFTDYCRAINALYYELIATQVLSMALAMMLSFCINLSSFHMPSAIFF 309

  Fly   289 ADIWTGLATVAYINGLMVQTFPFCFVCDLLKKDCELLVSAIFHSNWINSSRSYKSSLRYFLKNAQ 353
                   ...||...:      :|.:..:|:...:.:..:|.:..|...|...:....:.|:.:|
  Fly   310 -------VVSAYSMSI------YCILGTILEFAYDQVYESICNVTWYELSGEQRKLFGFLLRESQ 361

  Fly   354 KSIAFTAGSIFPISTGSNIKVAKLAFSV 381
            .........:..:|..:.:::.||.:||
  Fly   362 YPHNIQILGVMSLSVRTALQIVKLIYSV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 57/315 (18%)
Or83cNP_524244.2 7tm_6 69..387 CDD:251636 65/349 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465517
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.