DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98a and Orco

DIOPT Version :9

Sequence 1:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster


Alignment Length:425 Identity:69/425 - (16%)
Similarity:135/425 - (31%) Gaps:122/425 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 INTFTPNELL--TVMQLFFNSVGMPFKVLFFNLYISGFYKAKKLLSEMDKRCTTLKERVEVHQ-G 131
            :|....|||.  |:..|||......|..|..|.  ..||:...:.::::......:.....|. .
  Fly    66 LNAEEVNELSGNTITTLFFTHCITKFIYLAVNQ--KNFYRTLNIWNQVNTHPLFAESDARYHSIA 128

  Fly   132 VVRCNKAYLIYQFI----YTAYTISTFL------------SAALSGKLPWRIYNPFVDFRESRSS 180
            :.:..|.:.:....    .||:|..||.            ::::..::|......|..:..|...
  Fly   129 LAKMRKLFFLVMLTTVASATAWTTITFFGDSVKMVVDHETNSSIPVEIPRLPIKSFYPWNASHGM 193

  Fly   181 FWKAALN-ETALMLFAVTQTLMSDIY---PLLYGLILRVHLK-----LLRLRV------------ 224
            |:..:.. :...:||::..:.:.|:.   .|::......|||     |:.|..            
  Fly   194 FYMISFAFQIYYVLFSMIHSNLCDVMFCSWLIFACEQLQHLKGIMKPLMELSASLDTYRPNSAAL 258

  Fly   225 -ESLCTDSGKSDAENEQ------------------------------------------------ 240
             .||..:|......||:                                                
  Fly   259 FRSLSANSKSELIHNEEKDPGTDMDMSGIYSSKADWGAQFRAPSTLQSFGGNGGGGNGLVNGANP 323

  Fly   241 ------------DLIK-CIKDHNLIIDYAAAIRPAVTRTIFVQFLLIGICLGL--------SMIN 284
                        ..|| .::.|..::...|||.......:.:..|...|.|.|        :.:|
  Fly   324 NGLTKKQEMMVRSAIKYWVERHKHVVRLVAAIGDTYGAALLLHMLTSTIKLTLLAYQATKINGVN 388

  Fly   285 LLFFADIWTGLATVAYINGLMVQTFPFCFVCDLLKKDCELLVSAIFHSNWINSSRSYKSSLRYFL 349
            :..|       ..|.|:...:.|.|.||...:.|.::...::.|.:..:|.:.|...|:.::...
  Fly   389 VYAF-------TVVGYLGYALAQVFHFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVC 446

  Fly   350 KNAQKSIAFTAGSIFPISTGSNIKVAKLAFSVVTF 384
            :..||:::.:....|.:|..   ..|.:..:|||:
  Fly   447 QQCQKAMSISGAKFFTVSLD---LFASVLGAVVTY 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 65/414 (16%)
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 65/413 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.