DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98a and Or67d

DIOPT Version :9

Sequence 1:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster


Alignment Length:389 Identity:75/389 - (19%)
Similarity:135/389 - (34%) Gaps:80/389 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FCMGWHTPATHKIIYYITSCLIFAWCAVYLPIGIIISFKTDINTFTPNELLTVMQLFFNSVGMPF 93
            |.|.|.|.|....|.:..:|..:   .:|  :|::|:....|       :|..:.:..::|....
  Fly    36 FRMWWLTYAVMAAIAFFFACTGY---TIY--VGVVINGDLTI-------ILQALAMVGSAVQGLT 88

  Fly    94 KVL---------------FFNLYISGFYKAKKLLSEMDKRCTTLKERVEVHQGVVRCNKAYLI-Y 142
            |:|               :.::|       ::..|:.|:....|::|       :|.....|| :
  Fly    89 KLLVTANNASHMREVQNTYEDIY-------REYGSKGDEYAKCLEKR-------IRITWTLLIGF 139

  Fly   143 QFIY-----TAYTISTFLSAALSGK-LPWRIYNPFVDFRESRSSFWKAALNETALMLFAVTQTLM 201
            ..:|     ...|...|....|..| |..:...||:|...........|.: ..|:.|.......
  Fly   140 MLVYIILLGLVITFPIFYLLILHQKVLVMQFLIPFLDHTTDGGHLILTAAH-VILITFGGFGNYG 203

  Fly   202 SDIYPLLYGLILRVHLKLLRLRVESLCTDSGKSDAENEQDLIKCIKD--------------HNLI 252
            .|:|..|:    ..|:.|::   :..|.   |....||  |:....|              |.|.
  Fly   204 GDMYLFLF----VTHVPLIK---DIFCV---KLTEFNE--LVMKRNDFPKVRAMLCDLLVWHQLY 256

  Fly   253 IDYAAAIRPAVTRTIFVQFLLIGICLGLSMINLLFFADIWTGLATVAYINGLMVQTFPFCFVCDL 317
            .......:...:..:|||  |...|:||.......|...|.  |...|:....:..:.||.:..|
  Fly   257 TRMLQTTKKIYSIVLFVQ--LSTTCVGLLCTISCIFMKAWP--AAPLYLLYAAITLYTFCGLGTL 317

  Fly   318 LKKDCELLVSAIF-HSNWINSSRSYKSSLRYFLKNAQKSIAFTAGSIFPISTGSNIKVAKLAFS 380
            ::...|..:|.|: :..|.......:..:...|..||..:..||..:.|:|..:.:::.|..:|
  Fly   318 VENSNEDFLSVIYTNCLWYELPVKEEKLIIMMLAKAQNEVVLTAADMAPLSMNTALQLTKGIYS 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 63/341 (18%)
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 64/348 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465499
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.