DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98a and Or67b

DIOPT Version :9

Sequence 1:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524007.2 Gene:Or67b / 39120 FlyBaseID:FBgn0036019 Length:421 Species:Drosophila melanogaster


Alignment Length:325 Identity:69/325 - (21%)
Similarity:125/325 - (38%) Gaps:74/325 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 MQLFFNSVGMPFKVLFFNL-----YISGFYKAKKLLSEMDKRCTTLKERVEVHQGVVRCNKAYL- 140
            :..||..|.||  ||::.:     ||...|...|...||     ||     .:..:|    .|| 
  Fly   152 VMFFFKIVCMP--VLYYCVRPYFQYIFDCYIKDKDTCEM-----TL-----TYPAIV----PYLQ 200

  Fly   141 IYQFIYTAYTISTFLSAALSGKLPWRIYNPFVDFRESRSSFWKAALNETALMLFAVTQTLMSDIY 205
            :..:.:.:|.|..||  ..||.| |..:..|             ..|.    ||.|.....|   
  Fly   201 LGNYEFPSYVIRFFL--LQSGPL-WCFFAVF-------------GFNS----LFVVLTRYES--- 242

  Fly   206 PLLYGLILRVHLKLLRLRVESLCTDSGKSDAENEQDLIKCIK-------DHNLI---IDYAAAIR 260
                |||     |:||..|::..:|......:..:.|..|::       .||.|   ..|...::
  Fly   243 ----GLI-----KVLRFLVQNSTSDILVPKDQRVKYLQCCVRLFARISSHHNQIENLFKYIILVQ 298

  Fly   261 PAVTRTIFVQFLLIGICLGLSMIN-LLFFADIWTGLATVAYINGLMVQTFPFCFVCDLLKKDCEL 324
            .:|:..:        ||:.|..|: :|....:|.|:..|.::. :.::...:......::...||
  Fly   299 CSVSSIL--------ICMLLYKISTVLEVGWVWMGMIMVYFVT-IALEITLYNVSAQKVESQSEL 354

  Fly   325 LVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIAFTAGSIFPISTGSNIKVAKLAFSVVTFVNQLN 389
            |....::.:|.|.||.:|..::..|..::::...:.|....:|....::|.:|:.:....:..:|
  Fly   355 LFHDWYNCSWYNESREFKFMIKMMLLFSRRTFVLSVGGFTSLSHKFLVQVFRLSANFFLLLRNMN 419

  Fly   390  389
              Fly   420  419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 68/313 (22%)
Or67bNP_524007.2 7tm_6 <197..408 CDD:251636 51/251 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465199
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.