DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98a and Or63a

DIOPT Version :9

Sequence 1:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster


Alignment Length:365 Identity:67/365 - (18%)
Similarity:124/365 - (33%) Gaps:82/365 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 TVMQLFFNSVGMPFKVLFFNLYISGFYKAKKLLSEMDKRCTTLKERV-------EVHQGVVRCNK 137
            |.:| |..|:...:..||.:..|....: |....|:.::| .|.||:       |:.|.|.....
  Fly    80 TALQ-FLTSIAKMWYFLFAHRQIYELLR-KARCHELLQKC-ELFERMSDLPVIKEIRQQVESTMN 141

  Fly   138 AY--------LIYQF----IYTAYTISTFLSAALSGKLPWRIYNPFVDFRESRSSF--------- 181
            .|        |||.:    |.|.|.|::|            :.|.:..|.:.:.|:         
  Fly   142 RYWASTRRQILIYLYSCICITTNYFINSF------------VINLYRYFTKPKGSYDIMLPLPSL 194

  Fly   182 ---W------------KAALNETALMLFAVTQTLMSDIYPLLYGLILRVH----LKLLRLRVESL 227
               |            :..|...:|.:..:.......::     ::|.:|    ::.|...||..
  Fly   195 YPAWEHKGLEFPYYHIQMYLETCSLYICGMCAVSFDGVF-----IVLCLHSVGLMRSLNQMVEQA 254

  Fly   228 CTDSGKSDAENEQDLIKCIKDHNLIIDYAAAIRPAVTRTIFVQFLLIGICLGLSMINLLFFADIW 292
            .::....|...|. |..||..:..:.::|..:........|.||||.....||:    ||...:.
  Fly   255 TSELVPPDRRVEY-LRCCIYQYQRVANFATEVNNCFRHITFTQFLLSLFNWGLA----LFQMSVG 314

  Fly   293 TG-------LATVAYINGLMVQTFPFCFVCDLLKKDCELLVSAIFHSNWINSSRSYKSSLRYFLK 350
            .|       :....|:.....|...:|:.........|.:.:|.:...|...||.::..:|..|.
  Fly   315 LGNNSSITMIRMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRWYGESREFRHLIRMMLM 379

  Fly   351 NAQKSIAFTAGSIFPISTGSNIKVAKLA---FSVVTFVNQ 387
            ...:...........:|..:.:.:.:.:   |.::..|||
  Fly   380 RTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLLQNVNQ 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 63/355 (18%)
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 63/352 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465181
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.