DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98a and Or49a

DIOPT Version :9

Sequence 1:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:385 Identity:77/385 - (20%)
Similarity:137/385 - (35%) Gaps:68/385 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FRYFEYGMFCMGWHTPATHKIIYYITSCLIFAWCAVYLPIGIIISFKTDINTFTPNELLTVMQLF 85
            |:...|.:|    |||.              .|....|..|..:  ...|:.|....::|...:.
  Fly    18 FKTLGYDLF----HTPK--------------PWWRYLLVRGYFV--LCTISNFYEASMVTTRIIE 62

  Fly    86 FNSV-GMPFKVL-----FFNL------YISGFYKAKKLLSEMDKRCTTLKERVEVHQGVVRCNKA 138
            :.|: |.|.|::     ||.:      :|:.....|:|| ::..|...|....|.:|.....||.
  Fly    63 WESLAGSPSKIMRQGLHFFYMLSSQLKFITFMINRKRLL-QLSHRLKELYPHKEQNQRKYEVNKY 126

  Fly   139 YL---------IYQFIYTAYTISTFLSAALS-----GKLPW---RIYNPFVDF-RESRSSFWKAA 185
            ||         :|.|:.....:...:.:.:.     ||..:   ||:...:.| .|....:..|.
  Fly   127 YLSCSTRNVLYVYYFVMVVMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTFDSEKPLGYVLAY 191

  Fly   186 LNETALMLFAVTQTLMSDIYPLLYGLILRVHLKLLRLRVESLCTDSGKSDAENEQD----LIKCI 246
            :.:.....|.|..:|.:|::.:.....:.:||..|...:.|:     :...|.||.    |...|
  Fly   192 VIDFTYSQFIVNVSLGTDLWMMCVSSQISMHLGYLANMLASI-----RPSPETEQQDCDFLASII 251

  Fly   247 KDHNLIIDYAAAIRPAVTRTIFVQFLLIGICLGLSMINLLFFADI----WTGLATVAYINGLMVQ 307
            |.|.|:|.....:. .|...:....|....||   :..:.::..:    |.|::.:.....:..|
  Fly   252 KRHQLMIRLQKDVN-YVFGLLLASNLFTTSCL---LCCMAYYTVVEGFNWEGISYMMLFASVAAQ 312

  Fly   308 TFPFCFVCDLLKKDCELLVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIAFTAGSIFPIS 367
            .:.......:|......|..|.|.|.|...|..||..:...:..||:.:..:|..:..||
  Fly   313 FYVVSSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEISARGVIIIS 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 66/332 (20%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 59/295 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465995
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.