DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98a and Or47b

DIOPT Version :9

Sequence 1:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster


Alignment Length:367 Identity:74/367 - (20%)
Similarity:135/367 - (36%) Gaps:69/367 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 INTFTPNELLTVMQLFFNSVGMPFKVLFFN---LYISGFYKAKKLLSEMDKRCTTLKERV---EV 128
            ||.|....::|:....|.::.....|:...   ::|||.......:..|..||..:.|.:   |.
  Fly    64 INLFIMCNVMTIFWTMFVALPESKNVIEMGDDLVWISGMALVFTKIFYMHLRCDEIDELISDFEY 128

  Fly   129 HQGVVRCNK-----------AYLIYQFIY-TAYTISTFLSAAL-------SGKLPWRIYNPF--- 171
            :...:|.:.           .|:|...:| ..:.:..|.|||:       .||||:....||   
  Fly   129 YNRELRPHNIDEEVLGWQRLCYVIESGLYINCFCLVNFFSAAIFLQPLLGEGKLPFHSVYPFQWH 193

  Fly   172 -VDFRESRSSF---WKAALNETALMLFAVTQTLMSDIYPLLYGLILRVHLKLLRLRVESLCTDSG 232
             :|.......|   |::..::..||     ..||.|:..:...|...::||||.:.:..| .|..
  Fly   194 RLDLHPYTFWFLYIWQSLTSQHNLM-----SILMVDMVGISTFLQTALNLKLLCIEIRKL-GDME 252

  Fly   233 KSDAENEQDLIKCIKDHNLIIDYAA----AIRPAVTRTIFVQFLLIGIC-------------LGL 280
            .||....::..:.::.|..||....    |...|....:...|.||.|.             :..
  Fly   253 VSDKRFHEEFCRVVRFHQHIIKLVGKANRAFNGAFNAQLMASFSLISISTFETMAAAAVDPKMAA 317

  Fly   281 SMINLLFFADIWTGLATVAYINGLMVQTFPFCFVCDLLKKDCELLVSAIFHSNWINSSRSYKSSL 345
            ..:.|:..|.|...|..|   :|.:|.|           :..|:..:|...::|...|...:..:
  Fly   318 KFVLLMLVAFIQLSLWCV---SGTLVYT-----------QSVEVAQAAFDINDWHTKSPGIQRDI 368

  Fly   346 RYFLKNAQKSIAFTAGSIFPISTGSNIKVAKLAFSVVTFVNQ 387
            .:.:..|||.:.:.|....|.:.|:.:.|.|..:.::..:.:
  Fly   369 SFVILRAQKPLMYVAEPFLPFTLGTYMLVLKNCYRLLALMQE 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 71/353 (20%)
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 69/333 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.