DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98a and Or47a

DIOPT Version :9

Sequence 1:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523689.1 Gene:Or47a / 36187 FlyBaseID:FBgn0026386 Length:385 Species:Drosophila melanogaster


Alignment Length:384 Identity:77/384 - (20%)
Similarity:140/384 - (36%) Gaps:75/384 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IIYYITSCLIFAWCAVYLPIGIIISFKTDINTFTPNELLTVMQLFFNSVGMPFKVLFFNLYISGF 105
            |..:|.:.::..|..|.|....:::.           |:|::.||      .|.::   ||:...
  Fly    42 IFPFILAAVLHNWKNVLLLADAMVAL-----------LITILGLF------KFSMI---LYLRRD 86

  Fly   106 YKAKKLLSEMDKRCTTLKERVEVHQGVVRCNKAYLIYQFIYTAYTISTFLSAALSGKL------- 163
            :  |:|:.:.....:...|:.|.:..::  |.|....|.:.|.:.....|:.||:..|       
  Fly    87 F--KRLIDKFRLLMSNEAEQGEEYAEIL--NAANKQDQRMCTLFRTCFLLAWALNSVLPLVRMGL 147

  Fly   164 ------------------PWRIYNPFVDFRESRSSFWKAALNETALMLFAVT-QTLMSDIYPLLY 209
                              ||.|:    ..|....||..:|...|.::|.||: .|:.......|.
  Fly   148 SYWLAGHAEPELPFPCLFPWNIH----IIRNYVLSFIWSAFASTGVVLPAVSLDTIFCSFTSNLC 208

  Fly   210 GLILRVHLKLLRLRVESLCTDSGKSDAENEQDLIKCIKDHNLIIDYAAAIRPAVTRTIFVQFLLI 274
            ........|::|.:        |.|..|::..|.|....:...:|....:.......|..||.:.
  Fly   209 AFFKIAQYKVVRFK--------GGSLKESQATLNKVFALYQTSLDMCNDLNQCYQPIICAQFFIS 265

  Fly   275 GICLGLSMINLLF---FADIWTGLATVAYINGLMVQTFPFCFVCDLLKKDCELLVSAIFHSNWIN 336
            .  |.|.|:..||   ||.. .|:...::|..:::|.:.:|:..:.||.:......||:.|.|..
  Fly   266 S--LQLCMLGYLFSITFAQT-EGVYYASFIATIIIQAYIYCYCGENLKTESASFEWAIYDSPWHE 327

  Fly   337 S------SRSYKSSLRYFLKNAQKSIAFTAGSIFPISTGSNIKVAKLAFSVVTFVNQLN 389
            |      |.|...||...:..|.:....| |..|..:..:...:.:.|.|.:|.:...:
  Fly   328 SLGAGGASTSICRSLLISMMRAHRGFRIT-GYFFEANMEAFSSIVRTAMSYITMLRSFS 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 69/339 (20%)
Or47aNP_523689.1 7tm_6 56..375 CDD:251636 71/358 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465575
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.