DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98a and Or45b

DIOPT Version :9

Sequence 1:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster


Alignment Length:329 Identity:66/329 - (20%)
Similarity:117/329 - (35%) Gaps:99/329 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 KAKKLLSEMDKRCTTLKERVE--VHQGVVRCNKAYLIYQFIYTAYTIST--FLSAAL-------- 159
            :.:.|:.|.:||..:.::..:  .:..|.||.      ..::|..:|:|  |:..:|        
  Fly   105 RIRLLIGEQEKREDSRRKVAQRSYYLMVTRCG------MLVFTLGSITTGAFVLRSLWEMWVRRH 163

  Fly   160 ---SGKLPWRIYNPFVDFRESRSSF--------WKAALNETALMLFAVTQTLMSDIYPLLYGLIL 213
               ...:|:|:.  |.||......|        |.   .:..:..||.|.       ...:|..|
  Fly   164 QEFKFDMPFRML--FHDFAHRMPWFPVFYLYSTWS---GQVTVYAFAGTD-------GFFFGFTL 216

  Fly   214 RVHLKLLRLRVESLCTDSGKSDAENEQDLIKCIKDHNL------------IIDYAAAIRPAV--- 263
            .:...|..||.:.             ||.:|.|:|.:|            |:|....|...|   
  Fly   217 YMAFLLQALRYDI-------------QDALKPIRDPSLRESKICCQRLADIVDRHNEIEKIVKEF 268

  Fly   264 ----TRTIFVQFLLIGICLGLSMINLLFFADIWTGLATVAYINGLMVQTFP-------FCFVCDL 317
                ....||.|:...:.:..|:|::|    :::|...:.|:    |.||.       :|:....
  Fly   269 SGIMAAPTFVHFVSASLVIATSVIDIL----LYSGYNIIRYV----VYTFTVSSAIFLYCYGGTE 325

  Fly   318 LKKDCELLVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIA----FTAGSIFPI------STGSNI 372
            :..:...|..|.:.|.|....|..:..:...:..||:.|.    |.|.|: |:      .|||.:
  Fly   326 MSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPITVRVPFFAPSL-PVFTSVIKFTGSIV 389

  Fly   373 KVAK 376
            .:||
  Fly   390 ALAK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 66/329 (20%)
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 61/320 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465145
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.