DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98a and Or43a

DIOPT Version :9

Sequence 1:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523647.2 Gene:Or43a / 35644 FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster


Alignment Length:253 Identity:48/253 - (18%)
Similarity:94/253 - (37%) Gaps:56/253 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 IYQFIYTAYTISTFLSAALSGKLPWRIYNPFVDFRESRSSFWKAALNETALMLFAVTQTLMSDIY 205
            :|:.||.|...:..|.:.:        |.|||......:.|.||                     
  Fly   166 VYEVIYLAQLPTPLLLSMM--------YMPFVSLFAGLAIFGKA--------------------- 201

  Fly   206 PLLYGLILRVHLKLLRLRVESLCTDSGKSDAENE--QDLIKCIKDHNLIIDYAAAIRPAVTRTIF 268
                         :|::.|..|....|:..:|.|  |.|..||..|..::.|...:...|...:.
  Fly   202 -------------MLQILVHRLGQIGGEEQSEEERFQRLASCIAYHTQVMRYVWQLNKLVANIVA 253

  Fly   269 VQFLLIG--ICLGLSMINLLFFADIWTG----LATVAYINGLMVQTFPFCFVCDLLKKDCELLVS 327
            |:.::.|  ||      :|||..:|.|.    ::.|.||..::...|.:....:.:..:...:..
  Fly   254 VEAIIFGSIIC------SLLFCLNIITSPTQVISIVMYILTMLYVLFTYYNRANEICLENNRVAE 312

  Fly   328 AIFHSNWINSSRSYKSSLRYFLKNAQKSIAFTAGSIFPISTGSNIKVAKLAFSVVTFV 385
            |:::..|..:...::.:|..||...|..:....|:::|::......:...::|..|.:
  Fly   313 AVYNVPWYEAGTRFRKTLLIFLMQTQHPMEIRVGNVYPMTLAMFQSLLNASYSYFTML 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 46/245 (19%)
Or43aNP_523647.2 7tm_6 56..364 CDD:251636 46/245 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465794
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.