DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98a and Or33a

DIOPT Version :9

Sequence 1:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster


Alignment Length:406 Identity:95/406 - (23%)
Similarity:172/406 - (42%) Gaps:68/406 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RKPNPTNLLTSPDSFRYFEYGMFCMGWHT-------PATHKIIYYITSCLIFAWCAVYLPIGIII 64
            ||....||           |..:.:.|..       |....:.:.|||     :..:..|:.:|:
  Fly     5 RKVRSENL-----------YKTYWLYWRLLGVEGDYPFRRLVDFTITS-----FITILFPVHLIL 53

  Fly    65 SF--KTDINTFTPNELLTVMQLFFNS--VGMPFKVLFFNLYISGFYKAKKLLSEMDKRCTTLKER 125
            ..  |..|..|        ..|.|.|  :...:|...|...:......:.||.::|.|..:.:||
  Fly    54 GMYKKPQIQVF--------RSLHFTSECLFCSYKFFCFRWKLKEIKTIEGLLQDLDSRVESEEER 110

  Fly   126 VEVHQGVVR----CNKAYLIYQFIYTAYTISTFLSAALSG---------KLPWRIYNPFVDFRES 177
            ...:|...|    .:|:||:       ..||..::|.::|         .|.|..|    ||:.:
  Fly   111 NYFNQNPSRVARMLSKSYLV-------AAISAIITATVAGLFSTGRNLMYLGWFPY----DFQAT 164

  Fly   178 RSSFWKA----ALNETALMLFAVTQTLMSDIYPLLYGLILRVHLKLLRLRVESLCTDSGKSDAEN 238
            .:.:|.:    |:..:.|:|    :.|.:|.||.:...::..|::||.:|:..:..|...|.:||
  Fly   165 AAIYWISFSYQAIGSSLLIL----ENLANDSYPPITFCVVSGHVRLLIMRLSRIGHDVKLSSSEN 225

  Fly   239 EQDLIKCIKDHNLIIDYAAAIRPAVTRTIFVQFLLIGICLGLSMINLLFFAD-IWTGLATVAYIN 302
            .:.||:.|:||..::.....:|..:..:...|||..||.:.:::||:||||: .:..|....:..
  Fly   226 TRKLIEGIQDHRKLMKIIRLLRSTLHLSQLGQFLSSGINISITLINILFFAENNFAMLYYAVFFA 290

  Fly   303 GLMVQTFPFCFVCDLLKKDCELLVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIAFTAGSIFPIS 367
            .::::.||.|:...|:..:.:.|..|||.|||:...:.|..||...::.....:...||.|..|.
  Fly   291 AMLIELFPSCYYGILMTMEFDKLPYAIFSSNWLKMDKRYNRSLIILMQLTLVPVNIKAGGIVGID 355

  Fly   368 TGSNIKVAKLAFSVVT 383
            ..:.....::|:|..|
  Fly   356 MSAFFATVRMAYSFYT 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 77/324 (24%)
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 79/328 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468648
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.