DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98a and Or22b

DIOPT Version :9

Sequence 1:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster


Alignment Length:396 Identity:149/396 - (37%)
Similarity:238/396 - (60%) Gaps:11/396 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FNYLRKPNPTNLLTSPDSFRYFEYGMFCMGWHTPATHK--IIYYITSCLIFAWCAVYLPIGIIIS 65
            |.::::...:..:.|.|:|.|.:..|:..||..|...:  :.|.:.|..:.....:.|||.:.:.
  Fly     6 FPHIKEKPLSERVKSRDAFVYLDRVMWSFGWTVPENKRWDLHYKLWSTFVTLLIFILLPISVSVE 70

  Fly    66 FKTDINTFTPNELLTVMQLFFNSVGMPFKVLFFNLYISGFYK---AKKLLSEMDKRCTTLKERVE 127
            :.....||:..|.|:.:|:..|..|..||..   |.:.|:.|   ||..|.|:||||...:||..
  Fly    71 YIQRFKTFSAGEFLSSIQIGVNMYGSSFKSY---LTMMGYKKRQEAKMSLDELDKRCVCDEERTI 132

  Fly   128 VHQGVVRCNKAYLIYQFIYTAYTISTFLSAALSGKLPWRIYNPFVDFRESRSSFWKAALNETALM 192
            ||:.|...|..|:.|...||::.||.|||..:.....||:|.|:||   ....|:.:::.|..|.
  Fly   133 VHRHVALGNFCYIFYHIAYTSFLISNFLSFIMKRIHAWRMYFPYVD---PEKQFYISSIAEVILR 194

  Fly   193 LFAVTQTLMSDIYPLLYGLILRVHLKLLRLRVESLCTDSGKSDAENEQDLIKCIKDHNLIIDYAA 257
            .:||...|.:|:.||:..:|.|.|:.||:.|:.:|.::.|:::.|..::|..|::||.||:||..
  Fly   195 GWAVFMDLCTDVCPLISMVIARCHITLLKQRLRNLRSEPGRTEDEYLKELADCVRDHRLILDYVD 259

  Fly   258 AIRPAVTRTIFVQFLLIGICLGLSMINLLFFADIWTGLATVAYINGLMVQTFPFCFVCDLLKKDC 322
            |:|...:.|||||||||||.|||||||::||:.:.||:|.|.:::.:.:||||||::|:::..||
  Fly   260 ALRSVFSGTIFVQFLLIGIVLGLSMINIMFFSTLSTGVAVVLFMSCVSMQTFPFCYLCNMIMDDC 324

  Fly   323 ELLVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIAFTAGSIFPISTGSNIKVAKLAFSVVTFVNQ 387
            :.:..::|.|:|.::.|.|||:|.|||.|.|:.|..|||.:||||..:|:.:.||||:|||.|.|
  Fly   325 QEMADSLFQSDWTSADRRYKSTLVYFLHNLQQPIILTAGGVFPISMQTNLNMVKLAFTVVTIVKQ 389

  Fly   388 LNIADR 393
            .|:|::
  Fly   390 FNLAEK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 124/307 (40%)
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 124/305 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468539
Domainoid 1 1.000 64 1.000 Domainoid score I17159
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I7489
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.