DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98a and Or82a

DIOPT Version :9

Sequence 1:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_730794.1 Gene:Or82a / 318778 FlyBaseID:FBgn0041621 Length:385 Species:Drosophila melanogaster


Alignment Length:421 Identity:86/421 - (20%)
Similarity:168/421 - (39%) Gaps:94/421 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FRYFEYGMFCMGWH------TPATHKIIYYITSCLIFAWCAVYLPIGIIISFKTDINTFTP---- 75
            |:..||.:..|| |      |.:|...:.:|:| |||...|.|..|..:...:.|:...|.    
  Fly     5 FQLQEYCLRAMG-HKDDMDSTDSTALSLKHISS-LIFVISAQYPLISYVAYNRNDMEKVTACLSV 67

  Fly    76 --NELLTVMQLFFNSVGMPFKVLFFNLYISGFYKAKKLLSEMDKRCTTLKERVEVH-----QGVV 133
              ..:|||::                  ||.|...:|...||..|...:.|:...|     :|:.
  Fly    68 VFTNMLTVIK------------------ISTFLANRKDFWEMIHRFRKMHEQSASHIPRYREGLD 114

  Fly   134 RCNKAYLIYQFIYTAYTISTFLS-------------------AALSGKLPWRIYNPFVDFRESRS 179
            ...:|..:..|:..||.:|..|:                   .....:||..:..||.|....  
  Fly   115 YVAEANKLASFLGRAYCVSCGLTGLYFMLGPIVKIGVCRWHGTTCDKELPMPMKFPFNDLESP-- 177

  Fly   180 SFWKAALNETALMLFAVTQTLMSDIYP-------LLYGLILRVHLKLLRLRVESLCTDSGKSDAE 237
                   ......|:.|..|::...|.       :.:.:.||.|.:.|:.::|:  .:...|:.:
  Fly   178 -------GYEVCFLYTVLVTVVVVAYASAVDGLFISFAINLRAHFQTLQRQIEN--WEFPSSEPD 233

  Fly   238 NEQDLIKCIKDHNLIIDYAAAIRPAVTRTIFVQFLLIGICLGL----------SMINLLFFADIW 292
            .:..|...::.|.|::..:..:|...|.|:..||::..:.:|:          |:::||.:|   
  Fly   234 TQIRLKSIVEYHVLLLSLSRKLRSIYTPTVMGQFVITSLQVGVIIYQLVTNMDSVMDLLLYA--- 295

  Fly   293 TGLATVAYINGLMVQTFPFCFVCDLLKKDCELLVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIA 357
                  ::...:|:|.|.:|:..:::|.:...:.:|:..|||..:|...::||...:..:||.:.
  Fly   296 ------SFFGSIMLQLFIYCYGGEIIKAESLQVDTAVRLSNWHLASPKTRTSLSLIILQSQKEVL 354

  Fly   358 FTAGSIFPISTGSNIKVAKLAFSVVTFVNQL 388
            ..|| .|..|..:.:.:.:.|.|::|.:..:
  Fly   355 IRAG-FFVASLANFVGICRTALSLITLIKSI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 66/351 (19%)
Or82aNP_730794.1 7tm_6 65..374 CDD:251636 65/347 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465611
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.