DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98a and Or65b

DIOPT Version :9

Sequence 1:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster


Alignment Length:431 Identity:77/431 - (17%)
Similarity:157/431 - (36%) Gaps:95/431 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DSFRYFEYGMFCMGWHT------PATHKIIYY----ITSCLIFA------------W-CAVYLPI 60
            |..|:.::  :.:||.|      .|:|..|||    :.:..:|.            | ..||  |
  Fly     2 DIQRFLKF--YKVGWKTYRDPLMEASHSSIYYWREQMKAMALFTTTEERLLPYRSKWHTLVY--I 62

  Fly    61 GIIISFKTDINTFTPN---------ELLTVMQLFFNSVGMPFKVLFFNLYISGFYKAKKLLSEMD 116
            .::|.|.:.....|.:         :|..::..||    :.||..:|..|..   :..:::|::|
  Fly    63 QMVIFFASMSFGLTESMGDHVQMGRDLAFILGAFF----IIFKTYYFCWYGD---ELDQVISDLD 120

  Fly   117 KRCTTLKE---RVEVHQGVVRCNKAYLIYQFIYTAYTISTFLSAAL-----------SGKLPWRI 167
            ......::   .||...|    .:.|.:..| :.|.:.|.||...|           ...||:..
  Fly   121 ALHPWAQKGPNPVEYQTG----KRWYFVMAF-FLATSWSFFLCILLLLLITSPMWVHQQNLPFHA 180

  Fly   168 YNPFVDFRESRSSFWKAALNETALMLFAVTQTLMSDIYPLLY-----GLILRVHLKLLRLRVESL 227
            ..||        .:.:.:|:..:..:..:.|:..: :|.|.:     ||.:.::.: :...:|.|
  Fly   181 AFPF--------QWHEKSLHPISHAIIYLFQSYFA-VYCLTWLLCIEGLSICIYAE-ITFGIEVL 235

  Fly   228 CTDSGKSDAEN------EQDLIKCIKDHNLIIDYAAAIRPAVTRTIFVQFLLIGICLGLSMINLL 286
            |.:..:....|      ..:..:.:|.|..|::...........|:.:|   :|:...|..:::|
  Fly   236 CLELRQIHRHNYGLQELRMETNRLVKLHQKIVEILDRTNDVFHGTLIMQ---MGVNFSLVSLSVL 297

  Fly   287 FFADIWTGLATVAYINGLM------VQTFPFCFVCDLLKKDCELLVSAIFHSNWINSSRSYKSSL 345
            ...:.......||....||      :..:.:| ...|.:|..::..:|....:....|:.....|
  Fly   298 EAVEARKDPKVVAQFAVLMLLALGHLSMWSYC-GDQLSQKSLQISEAAYEAYDPTKGSKDVYRDL 361

  Fly   346 RYFLKNAQKSIAFTAGSIFPISTGSNIK-VAKLAFSVVTFV 385
            ...::..|..:...| |.||.....|.. :....:.::||:
  Fly   362 CVIIRRGQDPLIMRA-SPFPSFNLINYSAILNQCYGILTFL 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 58/345 (17%)
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 57/338 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465235
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.