DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98a and Or65a

DIOPT Version :9

Sequence 1:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_729161.1 Gene:Or65a / 318011 FlyBaseID:FBgn0041625 Length:417 Species:Drosophila melanogaster


Alignment Length:391 Identity:73/391 - (18%)
Similarity:155/391 - (39%) Gaps:94/391 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 YYITSCLIFAWCAVYL----PIGIIISFKTDINTFTPNELLTVMQLFFNSVGMPFKVLFFNLYIS 103
            |:::..|..|..:::.    .||.|::...|        |:.::.:.|    :.|:::||..|  
  Fly    68 YFVSIQLATALASLFYGISESIGDIVNLGRD--------LVFIITIIF----ICFRLVFFAQY-- 118

  Fly   104 GFYKAKKLLSEMDKRCTTLKERVEVHQGVVR------CNKAYLIYQFIYTAYTISTF----LSAA 158
                    ..|:|.....|:   :::...::      ..:...::..::.|..|:.|    |...
  Fly   119 --------AGELDVIIDALE---DIYHWSIKGPATKEVQETKRLHFLLFMALIITWFSFLILFML 172

  Fly   159 LSGKLPWRIYNPFVDFRESRSSFWKAALNETA------LMLFAVTQTLMSDIYPLLY-GLILRVH 216
            :....|:.|.:..:.|..|    |...|::.:      :::|....|.|  :|.|:: |::..:.
  Fly   173 IKISTPFWIESQTLPFHVS----WPFQLHDPSKHPIAYIIIFVSQSTTM--LYFLIWLGVVENMG 231

  Fly   217 LKLL-----RLRVESLCTDSGKSDAENEQDLIKCIKDHNLIIDYAAAIRPAVTRTIFVQFLLI-- 274
            :.|.     .|||  ||.     :..|.|:|  |:.|.:::      .|.....|.|.|.:::  
  Fly   232 VSLFFELTSALRV--LCI-----ELRNLQEL--CLGDEDML------YRELCRMTKFHQQIILLT 281

  Fly   275 --------GICLGLSMIN-LLFFADIWTGLA-------TVAYINGLMVQTFPFCF---VCDLLKK 320
                    |..:...:|| ||....::..||       .|.|:..:::......|   ..|:..|
  Fly   282 DRCNHIFNGAFIMQMLINFLLVSLSLFEVLAAKKNPQVAVEYMIIMLMTLGHLSFWSKFGDMFSK 346

  Fly   321 DCELLVSAIFHSNWIN-SSRSYKSSLRYFLKNAQKSIAFTAGSIFPISTGSNIKVAKLAFSVVTF 384
            :.|.:..|::.:...| .|:|......:|::.|||.:...|....|.:..:.:.:.|..:|::|.
  Fly   347 ESEQVALAVYEAYDPNVGSKSIHRQFCFFIQRAQKPLIMKASPFPPFNLENYMFILKQCYSILTI 411

  Fly   385 V 385
            :
  Fly   412 L 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 64/348 (18%)
Or65aNP_729161.1 7tm_6 145..406 CDD:251636 55/281 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465253
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.