DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98a and Or46a

DIOPT Version :9

Sequence 1:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_995793.1 Gene:Or46a / 2768728 FlyBaseID:FBgn0026388 Length:384 Species:Drosophila melanogaster


Alignment Length:412 Identity:82/412 - (19%)
Similarity:154/412 - (37%) Gaps:66/412 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LTSPDSFRYFEYGMFCMG-WHTP---ATHKIIYYITSCLIFAWCAVYLPIGIII-SFKTDINTFT 74
            :.:.|.::|..:....:| |..|   |.|:..:   ..:.|.:..|.|.|.::: ||:...|...
  Fly     1 MVTEDFYKYQVWYFQILGVWQLPTWAADHQRRF---QSMRFGFILVILFIMLLLFSFEMLNNISQ 62

  Fly    75 PNELLTVMQLFFNSVGMPFKVLFFNLYISGFYKAKKLLSEMDKRCTT---LKERVEVHQ------ 130
            ..|:|.|..:|...:....|:|...|      |::||...:|...:.   :|...|:..      
  Fly    63 VREILKVFFMFATEISCMAKLLHLKL------KSRKLAGLVDAMLSPEFGVKSEQEMQMLELDRV 121

  Fly   131 GVVRCNKAYLIY-----QFIYTAYTISTFLSAALSGKLPWRIYNPFVDFRESRSSFWKAALNETA 190
            .|||...:|.|.     ..|........|      |:||..:..  |...|....:|...|..:.
  Fly   122 AVVRMRNSYGIMSLGAASLILIVPCFDNF------GELPLAMLE--VCSIEGWICYWSQYLFHSI 178

  Fly   191 LML--FAVTQTLMSDIYPLLYGLILRVHLKLLRLRVESLCTDSGKSDAEN-EQDLIKCIKDHNLI 252
            .:|  ..:..|..|..|.||  ..|:|.|::|.||:|.|.......|.|. ..:|.:|...:|.|
  Fly   179 CLLPTCVLNITYDSVAYSLL--CFLKVQLQMLVLRLEKLGPVIEPQDNEKIAMELRECAAYYNRI 241

  Fly   253 IDYAAAIRPAVTRTIFVQFLLIGICLGLSMINLLFFADIWTGLATVAYING-------------- 303
            :.:...:...:.....||.:    |..|.:::.|:      .::|::..||              
  Fly   242 VRFKDLVELFIKGPGSVQLM----CSVLVLVSNLY------DMSTMSIANGDAIFMLKTCIYQLV 296

  Fly   304 LMVQTFPFCFVCDLLKKDCELLVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIAF-TAGSIFPIS 367
            ::.|.|..|:..:.:......|..:|:.|.|...:|:.:..:...::.....:.. |....|..|
  Fly   297 MLWQIFIICYASNEVTVQSSRLCHSIYSSQWTGWNRANRRIVLLMMQRFNSPMLLSTFNPTFAFS 361

  Fly   368 TGSNIKVAKLAFSVVTFVNQLN 389
            ..:...:...::|....:.::|
  Fly   362 LEAFGSIVNCSYSYFALLKRVN 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 66/336 (20%)
Or46aNP_995793.1 7tm_6 62..373 CDD:251636 66/336 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466098
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.