DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets98B and spi1a

DIOPT Version :9

Sequence 1:NP_524535.2 Gene:Ets98B / 43334 FlyBaseID:FBgn0005659 Length:518 Species:Drosophila melanogaster
Sequence 2:XP_005163238.1 Gene:spi1a / 751704 ZFINID:ZDB-GENE-060825-351 Length:257 Species:Danio rerio


Alignment Length:173 Identity:49/173 - (28%)
Similarity:78/173 - (45%) Gaps:40/173 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 YADQPAHQQHSQQSASTD-HWPASYAMPHLDLDYNEDSEDDDDMEADAQVAPLNGSTTSPPATNA 407
            |...|.:|:......||| ..|...:.|   .:.:|..||.|                ..|:|::
Zfish   104 YISHPLYQRSPVPHCSTDEEEPGGRSPP---FEVSEGEEDHD----------------GHPSTSS 149

  Fly   408 SNGGTATVKRPNGGRTGGGGSHIHLWQFLKELLASPQVNGTAIRWIDRSKGIFKIEDSVR--VAK 470
            :..|.   ||           .:.|:|||.:||....:. ..|.|:||.:|:|:.....:  :|.
Zfish   150 TLSGN---KR-----------KVRLYQFLLDLLQDGDMR-DCIWWVDRERGVFQFSSKHKETLAS 199

  Fly   471 LWGRRK-NRPAMNYDKLSRSIRQYYKKGIMKKTERSQRLVYQF 512
            .||::| ||..|.|.|::|::|.|.|.|.:||.::  :|.|||
Zfish   200 RWGQQKGNRKRMTYQKMARALRNYGKTGEVKKVKK--KLTYQF 240

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity