DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets98B and SPIB

DIOPT Version :9

Sequence 1:NP_524535.2 Gene:Ets98B / 43334 FlyBaseID:FBgn0005659 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_003112.2 Gene:SPIB / 6689 HGNCID:11242 Length:262 Species:Homo sapiens


Alignment Length:269 Identity:65/269 - (24%)
Similarity:98/269 - (36%) Gaps:82/269 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 FEPVISLALEHAKREADAICAELQISQDPNGWSPAQVHAWLRSTLAQFRLPPVADLELHFCENGA 312
            |:|. :.|..|.  :|..:|.|      |..:|||          ....|.|..:..      |.
Human    61 FDPA-AAAFSHP--QAAQLCYE------PPTYSPA----------GNLELAPSLEAP------GP 100

  Fly   313 ALALLSEEEFVRRLPESGSTLHAQLEIWKMAYADQPAHQQHSQQSASTDHWPASYAMPHLDLDYN 377
            .|.....|.|            |...:...|||..|:.....::....|       .|.|::   
Human   101 GLPAYPTENF------------ASQTLVPPAYAPYPSPVLSEEEDLPLD-------SPALEV--- 143

  Fly   378 EDSEDDDDMEADAQVAPLNGSTTSPPATNASNGGTATVKRPNG-GRTGGGGSHIHLWQFLKELLA 441
            .|||.|:                            |.|..|.| |...|....:.|:|||..||.
Human   144 SDSESDE----------------------------ALVAGPEGKGSEAGTRKKLRLYQFLLGLLT 180

  Fly   442 SPQVNGTAIRWIDRSKGIFKIEDSVR--VAKLWGRRK-NRPAMNYDKLSRSIRQYYKKGIMKKTE 503
            ...:. ..:.|::...|:|:.....:  :|:.||::| ||..|.|.||:|::|.|.|.|.::|.:
Human   181 RGDMR-ECVWWVEPGAGVFQFSSKHKELLARRWGQQKGNRKRMTYQKLARALRNYAKTGEIRKVK 244

  Fly   504 RSQRLVYQF 512
            |  :|.|||
Human   245 R--KLTYQF 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets98BNP_524535.2 SAM_PNT-PDEF-like 264..345 CDD:188878 14/80 (18%)
ETS 429..517 CDD:197710 30/87 (34%)
SPIBNP_003112.2 TAD1 (Acidic) 1..31
TAD2 41..61 65/269 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..163 10/53 (19%)
ETS 168..256 CDD:197710 30/87 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3805
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11849
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.