DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets98B and SPI1

DIOPT Version :9

Sequence 1:NP_524535.2 Gene:Ets98B / 43334 FlyBaseID:FBgn0005659 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001074016.1 Gene:SPI1 / 6688 HGNCID:11241 Length:271 Species:Homo sapiens


Alignment Length:252 Identity:71/252 - (28%)
Similarity:107/252 - (42%) Gaps:56/252 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 SQDPNGWS--PAQVHAWLRSTLAQFRLPPVADLELHFCENGAALALLSEEEFVRRLPESGSTLHA 335
            |...:.|.  |..||:...|                |.||.     .:|.:.|:  |.....|:.
Human    46 SHSDHYWDFHPHHVHSEFES----------------FAENN-----FTELQSVQ--PPQLQQLYR 87

  Fly   336 QLEIWKMAYADQPAHQQHSQQSASTDHWPASYAMPHLDLDY-----NEDSEDDDDMEADAQVAPL 395
            .:|:.:|...|.|....|    .|..| ..|| :|.:.|.|     .:.|.|:::          
Human    88 HMELEQMHVLDTPMVPPH----PSLGH-QVSY-LPRMCLQYPSLSPAQPSSDEEE---------- 136

  Fly   396 NGSTTSPPATNASNGGTATVKRPNGGRTGGGGS--HIHLWQFLKELLASPQVNGTAIRWIDRSKG 458
             |...||| ...|:|....::...|...|..||  .|.|:|||.:||.|..:. .:|.|:|:.||
Human   137 -GERQSPP-LEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMK-DSIWWVDKDKG 198

  Fly   459 IFKIEDSVR--VAKLWGRRK-NRPAMNYDKLSRSIRQYYKKGIMKKTERSQRLVYQF 512
            .|:.....:  :|..||.:| ||..|.|.|::|::|.|.|.|.:||.::  :|.|||
Human   199 TFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKK--KLTYQF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets98BNP_524535.2 SAM_PNT-PDEF-like 264..345 CDD:188878 15/73 (21%)
ETS 429..517 CDD:197710 34/87 (39%)
SPI1NP_001074016.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..165 10/52 (19%)
Ets 172..253 CDD:395126 31/83 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3805
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11849
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.