DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets98B and Spib

DIOPT Version :9

Sequence 1:NP_524535.2 Gene:Ets98B / 43334 FlyBaseID:FBgn0005659 Length:518 Species:Drosophila melanogaster
Sequence 2:XP_006229173.1 Gene:Spib / 499146 RGDID:1565899 Length:287 Species:Rattus norvegicus


Alignment Length:268 Identity:64/268 - (23%)
Similarity:105/268 - (39%) Gaps:75/268 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 FEPVISLALEHAKREADAICAELQISQDPNGWSPAQVHAWLRSTLAQFRLPPVADLELHFCENGA 312
            |:|..:.|..|.  :|..:|  ......|:.:||...            |.|...||    .:|.
  Rat    81 FDPAATAAFAHT--QAVQLC--YGHGPSPSTYSPVGT------------LDPAPSLE----ASGP 125

  Fly   313 ALALLSEEEFVRRLPESGSTLHAQLEIWKMAYADQPAHQQHSQQSASTDHWPASYAMPHLDLDYN 377
            .|.:...|:|      :..||.:      :|||..|:.....::....|       .|.|::   
  Rat   126 GLQVYPSEDF------TSQTLGS------LAYAPYPSPVLSEEEDILLD-------SPALEV--- 168

  Fly   378 EDSEDDDDMEADAQVAPLNGSTTSPPATNASNGGTATVKRPNGGRTGGGGSHIHLWQFLKELLAS 442
            .|||.|:.:.|.::                           ..|...|....:.|:|||.|||..
  Rat   169 SDSESDEALLAGSE---------------------------GRGSEAGARKKLRLYQFLLELLLR 206

  Fly   443 PQVNGTAIRWIDRSKGIFKIEDSVR--VAKLWGRRK-NRPAMNYDKLSRSIRQYYKKGIMKKTER 504
            ..:. ..:.|::...|:|:.....:  :|:.||::| ||..|.|.||:|::|.|.|.|.::|.:|
  Rat   207 GDMR-ECVWWVEPGAGVFQFSSKHKELLARRWGQQKGNRKRMTYQKLARALRNYAKTGEIRKVKR 270

  Fly   505 SQRLVYQF 512
              :|.|||
  Rat   271 --KLTYQF 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets98BNP_524535.2 SAM_PNT-PDEF-like 264..345 CDD:188878 15/80 (19%)
ETS 429..517 CDD:197710 31/87 (36%)
SpibXP_006229173.1 ETS 193..281 CDD:197710 31/87 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3805
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11849
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.