DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets98B and spic

DIOPT Version :9

Sequence 1:NP_524535.2 Gene:Ets98B / 43334 FlyBaseID:FBgn0005659 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001004621.1 Gene:spic / 447882 ZFINID:ZDB-GENE-040912-47 Length:263 Species:Danio rerio


Alignment Length:198 Identity:52/198 - (26%)
Similarity:86/198 - (43%) Gaps:40/198 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 SEEEFVRRLPESGSTLHAQLEIWKMAYADQPAHQQHSQQSASTDHWPASYAMPHLDLDYNEDSED 382
            :|.::...|....|::...:..::..        .|.:...||..|..|.:.||           
Zfish    30 TENKYYENLDSQQSSVRHAISYYQFT--------PHFEPPGSTYDWNESSSWPH----------- 75

  Fly   383 DDDMEADAQVAPLNGSTTSPPATNASNGGTATVKRPNGGRTGGGGSHIHLWQFLKELLASPQVNG 447
               :..|..:..|..:.||  |..||        .|.  |.|.|...:.|:::|.|.|....: |
Zfish    76 ---VIPDVSLGSLCSTETS--AFYAS--------LPQ--RHGKGRKKLRLYEYLHEALHDDNM-G 124

  Fly   448 TAIRWIDRSKGIFKI--EDSVRVAKLWGRRK-NRPAMNYDKLSRSIRQYYKKGIMKKTERSQRLV 509
            .:|:|.||..|:|..  ::..::|:.||:|| ||..|.|.|::|::|.|.:.|.:.|..|  :|.
Zfish   125 DSIQWTDRGSGVFHFISKNKEKLAECWGQRKGNRKTMTYQKMARALRNYSRTGEIVKVRR--KLT 187

  Fly   510 YQF 512
            |||
Zfish   188 YQF 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets98BNP_524535.2 SAM_PNT-PDEF-like 264..345 CDD:188878 3/26 (12%)
ETS 429..517 CDD:197710 31/87 (36%)
spicNP_001004621.1 Ets 110..190 CDD:278602 29/82 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3805
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11849
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.