DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets98B and Ets97D

DIOPT Version :9

Sequence 1:NP_524535.2 Gene:Ets98B / 43334 FlyBaseID:FBgn0005659 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001263000.1 Gene:Ets97D / 43236 FlyBaseID:FBgn0004510 Length:484 Species:Drosophila melanogaster


Alignment Length:424 Identity:114/424 - (26%)
Similarity:177/424 - (41%) Gaps:123/424 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 KAEPLDADI------ESLIDLNSLLQQQS----------LQSPQNLQDTKPDHQLLRECLED--- 220
            :|||.|..|      |.|..|.||::|:.          ||..|.|:..|   .|:.:|::.   
  Fly    39 EAEPDDIIIVHMDIREPLSMLKSLVEQKIGVCLNYYTFWLQDAQELESHK---NLVDQCVKGEGL 100

  Fly   221 -------TSFQKRHN----LKPLALESFIGGLAE------------------------------- 243
                   .:.:||.|    |||  .|:.:..|||                               
  Fly   101 VQINVQIQTIRKRINIADVLKP--TEAALAALAEEVVGQLSPPETASQKSSSSESPIKTPLKRMH 163

  Fly   244 --------VRG-DFEPVISLALEHA-KREADAICAELQISQDPNGWSPAQVHAWLRSTLAQFRLP 298
                    |.| |.:||::..|:.. |||.    ..|:|.:..|.|:.|.|..||...:.||.|.
  Fly   164 KEDSEEESVEGKDVKPVLNWVLDSKFKREQ----IRLKIPEAANEWTHAHVTYWLEWAVKQFELV 224

  Fly   299 PV--ADLELHFCENGAALALLSEEEFVRRLP-ESGSTLHAQLEIWKMAYADQPAHQQHSQQ---- 356
            .:  :|.::    ||..|..::.|||.::|| :.|:.....|::.|........|::..:|    
  Fly   225 GINMSDWQM----NGQELCAMTHEEFNQKLPRDPGNIFWTHLQLLKECNFVSVVHKRAEEQRKPK 285

  Fly   357 --------SASTDHWPASYAMPHLDLDYNEDSEDDDDMEADAQVAPLNGSTTSPPATNASNGGTA 413
                    |.||:...:......:.....:..:..|.:|          ||||  :.|.||  ..
  Fly   286 QPRIMSANSISTNSGGSLSLEQRIMRKSYQSVKSSDSVE----------STTS--SMNPSN--YT 336

  Fly   414 TVKRPNGGRTGGGGSHIHLWQFLKELLASPQVNGTAIRWIDRSKGIFKIEDSVRVAKLWGRRKNR 478
            |:...|.|:       :.|||||.|:|...: :...|.|:. ::|.||:.|..|||:|||.:||:
  Fly   337 TIGSGNNGQ-------VQLWQFLLEILTDCE-HTDVIEWVG-TEGEFKLTDPDRVARLWGEKKNK 392

  Fly   479 PAMNYDKLSRSIRQYYKKGIMKKTERSQRLVYQF 512
            |||||:||||::|.||...::.|.. .:|..|:|
  Fly   393 PAMNYEKLSRALRYYYDGDMISKVS-GKRFAYKF 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets98BNP_524535.2 SAM_PNT-PDEF-like 264..345 CDD:188878 23/83 (28%)
ETS 429..517 CDD:197710 37/84 (44%)
Ets97DNP_001263000.1 GABP-alpha 48..123 CDD:288472 19/79 (24%)
SAM_PNT-GABP-alpha 184..272 CDD:176084 27/95 (28%)
ETS 345..429 CDD:197710 37/91 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450438
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11849
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.