Sequence 1: | NP_524535.2 | Gene: | Ets98B / 43334 | FlyBaseID: | FBgn0005659 | Length: | 518 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001303373.1 | Gene: | Ets65A / 38700 | FlyBaseID: | FBgn0005658 | Length: | 728 | Species: | Drosophila melanogaster |
Alignment Length: | 247 | Identity: | 71/247 - (28%) |
---|---|---|---|
Similarity: | 94/247 - (38%) | Gaps: | 89/247 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 348 PAHQQH--------SQQSASTDHWPASYAMPHLDLDYNEDSEDDDDMEADAQVAPLNGSTTSPPA 404
Fly 405 TNASNGGTAT---------VKRPNGGRTGGG-------------------GSH------------ 429
Fly 430 ----------------------------------IHLWQFLKELLASPQVNGTAIRWIDRSKGIF 460
Fly 461 KIEDSVRVAKLWGRRKNRPAMNYDKLSRSIRQYYKKGIMKKTERSQRLVYQF 512 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ets98B | NP_524535.2 | SAM_PNT-PDEF-like | 264..345 | CDD:188878 | |
ETS | 429..517 | CDD:197710 | 43/130 (33%) | ||
Ets65A | NP_001303373.1 | ETS | 316..401 | CDD:197710 | 42/84 (50%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR11849 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |