DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ets98B and edl

DIOPT Version :9

Sequence 1:	NP_524535.2	Gene:	Ets98B / 43334	FlyBaseID:	FBgn0005659	Length:	518	Species:	Drosophila melanogaster
Sequence 2:	NP_523786.2	Gene:	edl / 37149	FlyBaseID:	FBgn0023214	Length:	177	Species:	Drosophila melanogaster

Alignment Length:	65	Identity:	21/65 - (32%)
Similarity:	31/65 - (47%)	Gaps:	0/65 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   275 DPNGWSPAQVHAWLRSTLAQFRLPPVADLELHFCENGAALALLSEEEFVRRLPESGSTLHAQLEI 339
            ||..|:.|.|..||.:......|...|:|...|..||.||.|:|.:.::.|:|..|..|:....:
  Fly   103 DPRDWTRADVWKWLINMAVSEGLEVTAELPQKFPMNGKALCLMSLDMYLCRVPVGGKMLYRDFRV 167

Fly 340 339
Fly 168 167

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ets98B	NP_524535.2	SAM_PNT-PDEF-like	264..345	CDD:188878	21/65 (32%)
Ets98B	NP_524535.2	ETS	429..517	CDD:197710
edl	NP_523786.2	SAM_PNT-Mae	103..170	CDD:176086	21/65 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR11849
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	2	2.010