DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets98B and Spic

DIOPT Version :9

Sequence 1:NP_524535.2 Gene:Ets98B / 43334 FlyBaseID:FBgn0005659 Length:518 Species:Drosophila melanogaster
Sequence 2:XP_006241285.1 Gene:Spic / 314711 RGDID:1306272 Length:250 Species:Rattus norvegicus


Alignment Length:108 Identity:39/108 - (36%)
Similarity:66/108 - (61%) Gaps:13/108 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 TATVKRP----NGGRTGGGGSHIHLWQFLKELLASPQVNGTAIRWIDRSKGIFKI--EDSVRVAK 470
            |..|:.|    .|||   |...:.|:::|.|.|.:.:: .:.|:|:|::||||:.  ::..::|:
  Rat   101 TQLVQAPFFQEKGGR---GRRKLRLFEYLFESLCNSEM-VSCIQWVDKAKGIFQFISKNKEKLAE 161

  Fly   471 LWGRRK-NRPAMNYDKLSRSIRQYYKKGIMKKTERSQRLVYQF 512
            |||:|| ||..|.|.|::|::|.|.:.|.:.|..|  :|.|||
  Rat   162 LWGKRKGNRKPMTYQKMARALRNYARTGEITKIRR--KLTYQF 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets98BNP_524535.2 SAM_PNT-PDEF-like 264..345 CDD:188878
ETS 429..517 CDD:197710 32/87 (37%)
SpicXP_006241285.1 Ets 122..203 CDD:278602 32/84 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3805
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11849
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.