DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets98B and Spib

DIOPT Version :9

Sequence 1:NP_524535.2 Gene:Ets98B / 43334 FlyBaseID:FBgn0005659 Length:518 Species:Drosophila melanogaster
Sequence 2:XP_006540995.1 Gene:Spib / 272382 MGIID:892986 Length:286 Species:Mus musculus


Alignment Length:370 Identity:84/370 - (22%)
Similarity:134/370 - (36%) Gaps:116/370 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 CETPS----PRSSC--GESIKAEPLDADIESLIDLNSLLQQQSLQSPQNLQDTKPDHQLLRECLE 219
            |.:|:    |..||  ||.:...|       .:.|:||.|.     |:.:               
Mouse     4 CLSPARLDGPHLSCLVGEGVSPRP-------EMTLSSLRQY-----PEGV--------------- 41

  Fly   220 DTSFQKRHNLKPLALESFIGGLAEVRG--DFEPVISLALEHAKREADAICAELQISQ-------D 275
               |....:.||.:.....|||....|  :..|..::|...|...|.|..:..|..|       :
Mouse    42 ---FYDLDSCKPFSYPDSDGGLDSTWGWTEAPPAPAIAPYEAFDPATAAFSHSQTVQLCYSHGPN 103

  Fly   276 PNGWSPAQVHAWLRSTLAQFRLPPVADLELHFCENGAALALLSEEEFVRRLPESGSTLHAQLEIW 340
            |:.:||...            |.|...||    ..|..|.:...|:|      :..||.:     
Mouse   104 PSTYSPMGT------------LDPAPSLE----APGPGLQVYPPEDF------TSQTLGS----- 141

  Fly   341 KMAYADQPAHQQHSQQSASTDHWPASYAMPHLDLDYNEDSEDDDDMEADAQVAPLNGSTTSPPAT 405
             :|||..|:.....::....|       .|.|::   .|||.|:.:.|.::              
Mouse   142 -LAYAPYPSPVLSEEEDIMLD-------SPALEV---SDSESDEALLAGSE-------------- 181

  Fly   406 NASNGGTATVKRPNGGRTGGGGSHIHLWQFLKELLASPQVNGTAIRWIDRSKGIFKIEDSVR--V 468
                         ..|...|....:.|:|||..||....:. ..:.|::...|:|:.....:  :
Mouse   182 -------------GRGSEAGARKKLRLYQFLLGLLLRGDMR-ECVWWVEPGAGVFQFSSKHKELL 232

  Fly   469 AKLWGRRK-NRPAMNYDKLSRSIRQYYKKGIMKKTERSQRLVYQF 512
            |:.||::| ||..|.|.||:|::|.|.|.|.::|.:|  :|.|||
Mouse   233 ARRWGQQKGNRKRMTYQKLARALRNYAKTGEIRKVKR--KLTYQF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets98BNP_524535.2 SAM_PNT-PDEF-like 264..345 CDD:188878 17/87 (20%)
ETS 429..517 CDD:197710 30/87 (34%)
SpibXP_006540995.1 ETS 192..280 CDD:197710 30/87 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3805
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11849
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.