DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets98B and spib

DIOPT Version :9

Sequence 1:NP_524535.2 Gene:Ets98B / 43334 FlyBaseID:FBgn0005659 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001139456.1 Gene:spib / 100271885 XenbaseID:XB-GENE-479615 Length:273 Species:Xenopus tropicalis


Alignment Length:255 Identity:61/255 - (23%)
Similarity:102/255 - (40%) Gaps:67/255 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 DLELHFCENGAALALLSEEEFVRRLPESGSTLHAQLEIWKMAYADQPAHQQH------SQQSAST 360
            |||. |.::|.:.:..||.:....|            :|.:..|:.|.::.:      |.|:...
 Frog    24 DLEA-FNKHGNSYSQTSESDTQTDL------------LWSLIEAEDPGYETYDNIQLTSLQNVQL 75

  Fly   361 DHWPASYAMPHLD----LDYNEDSEDDDDMEADAQVA---------PLNGSTTSPPAT------- 405
            .:.|::|....||    ||..........:..|..:.         |:.|:..|||.:       
 Frog    76 PYLPSTYPQYCLDTLQALDGTVQCPAQCPLPDDLYIGEPYPPYATYPMPGNVPSPPLSEEEDFRH 140

  Fly   406 ---------------NASNGGTATVKRPNGGRTGGGGSHIHLWQFLKELLASPQVNGTAIRWIDR 455
                           |.|.|...       |...|....:.|::||.|||.:..:. ..|.|:||
 Frog   141 AESPPLEVSDSDSDENFSPGECI-------GYDPGVRKKVRLYKFLLELLQNGDMR-DCIWWLDR 197

  Fly   456 SKGIFKIEDSVR--VAKLWGRRK-NRPAMNYDKLSRSIRQYYKKGIMKKTERSQRLVYQF 512
            .:|.|:.....:  :|..||::| ||..|.|.|::|::|.|.|.|.::|.::  :|.|||
 Frog   198 ERGTFQFSSKHKELLAHRWGQQKGNRKKMTYQKMARALRNYGKTGEIRKVKK--KLTYQF 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets98BNP_524535.2 SAM_PNT-PDEF-like 264..345 CDD:188878 9/42 (21%)
ETS 429..517 CDD:197710 31/87 (36%)
spibNP_001139456.1 ETS 172..260 CDD:197710 31/87 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.