DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12877 and dnaQ

DIOPT Version :10

Sequence 1:NP_001034073.1 Gene:CG12877 / 43333 FlyBaseID:FBgn0039544 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_414751.1 Gene:dnaQ / 946441 ECOCYCID:EG10243 Length:243 Species:Escherichia coli


Alignment Length:158 Identity:38/158 - (24%)
Similarity:65/158 - (41%) Gaps:30/158 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   847 IELTRVTVVD--INGRSVYDALVKPDNQIVDYNTTYSGITEAMLSNETRTIRDVQAVLMSMFHAK 909
            ||:..|.||:  :.|.: :...:|||..:........||.:..|.::. |..:|....|......
E. coli    31 IEIGAVEVVNRRLTGNN-FHVYLKPDRLVDPEAFGVHGIADEFLLDKP-TFAEVADEFMDYIRGA 93

  Fly   910 TVLVGHSLESDLKALK-----LIHDV-------VVDTSVLFPHKMGPPKKRALKTLC----IENL 958
            .::: |:...|:..:.     |..|:       .|..|:....||.|.|:.:|..||    |:|.
E. coli    94 ELVI-HNAAFDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNS 157

  Fly   959 KRIIQESEAGHDSAEDAEVCIQLIKYYL 986
            ||.:      |.:..||::   |.:.||
E. coli   158 KRTL------HGALLDAQI---LAEVYL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12877NP_001034073.1 PTZ00121 <128..490 CDD:173412
PRK05035 <458..>583 CDD:481472
EloA-BP1 572..734 CDD:464914
REX1_like 834..983 CDD:99848 36/153 (24%)
dnaQNP_414751.1 PRK05711 3..243 CDD:235574 38/158 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.