DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12877 and REX4

DIOPT Version :9

Sequence 1:NP_001034073.1 Gene:CG12877 / 43333 FlyBaseID:FBgn0039544 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_014561.1 Gene:REX4 / 854075 SGDID:S000005440 Length:289 Species:Saccharomyces cerevisiae


Alignment Length:158 Identity:56/158 - (35%)
Similarity:80/158 - (50%) Gaps:15/158 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   835 ALDCEMCYTTHGIE-----LTRVTVVDINGRSVYDALVKPDNQIVDYNTTYSGITEAMLSNETRT 894
            |:|||  :...|.|     |.|:::|:..|..|.|..|||..::|::.|..|||....:.|.. |
Yeast   123 AMDCE--FVGVGPEGKESALARISIVNYFGHVVLDEFVKPREKVVEWRTWVSGIKPEHMKNAI-T 184

  Fly   895 IRDVQAVLMSMFHAKTVLVGHSLESDLKALKLIH--DVVVDTSVLFPHK--MGPPKKRALKTLCI 955
            .::.|.....:...: :||||:|:.||:||.|.|  .::.|||...|.:  ....|..:||.|..
Yeast   185 FKEAQKKTADILEGR-ILVGHALKHDLEALMLSHPKSLLRDTSRHLPFRKLYAKGKTPSLKKLTR 248

  Fly   956 ENLKRIIQESEAGHDSAEDAEVCIQLIK 983
            |.||..|||.|  |.|.|||...:.|.|
Yeast   249 EVLKISIQEGE--HSSVEDARATMLLYK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12877NP_001034073.1 CDC45 129..>199 CDD:280821
EloA-BP1 572..736 CDD:292495
REX1_like 834..983 CDD:99848 55/156 (35%)
DnaQ 847..>991 CDD:223916 51/146 (35%)
REX4NP_014561.1 REX4_like 122..274 CDD:99847 55/156 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.