DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12877 and REX3

DIOPT Version :9

Sequence 1:NP_001034073.1 Gene:CG12877 / 43333 FlyBaseID:FBgn0039544 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_013208.1 Gene:REX3 / 850797 SGDID:S000004097 Length:404 Species:Saccharomyces cerevisiae


Alignment Length:323 Identity:98/323 - (30%)
Similarity:164/323 - (50%) Gaps:49/323 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   680 KGKLSSLGNGEPF----DALDAEKAYKMVFDLRLTEEQLVENGYPRPGDKRGSAVIRACR-PNRR 739
            |..|||:||....    .|::|.||  ::.|.::.|    :|||          :::..: ....
Yeast    98 KPHLSSIGNANSITTKSKAMEALKA--LILDSKVLE----KNGY----------IVKEMQNKTND 146

  Fly   740 PNQKERY--CSRCGKVF-SLDIYEHQSFDMCNYHPKSTGYRRGFTDHQHRCCQQPAGTP-----G 796
            .|..:.|  |.||...| ..||.|.   .:|.|||....|.|...:||:.||.:...:.     |
Yeast   147 DNSTQLYAPCLRCSSNFKKTDIMEK---TLCRYHPLKRIYNRDTKNHQYPCCGETTDSVSFLRLG 208

  Fly   797 CTYANYHV--SDYYDPE-KLTCFVKTIERGEEFVPTKKDIYALDCEMCYTTHGIELTRVTVVD-I 857
            |....:||  .:.||.. |::.|..|     :.:...:::.:|||||.:|:.|.|:.|:|:|| .
Yeast   209 CKTFFHHVFRGESYDELCKISKFSST-----DDIDGVENVLSLDCEMAFTSLGYEMIRLTIVDFF 268

  Fly   858 NGRSVYDALVKPDNQIVDYNTTYSGITEAMLSNETRTIRDVQAVLMS--MFHAKTVLVGHSLESD 920
            .|::::|.:::|...|||.|:.:||:.|...:| ..|.::...|.:|  :.:..::|:||.||:|
Yeast   269 TGKTLFDHVIQPIGDIVDLNSDFSGVHEIDRTN-CPTYKEALDVFLSENLINKNSILIGHGLEND 332

  Fly   921 LKALKLIHDVVVDTSVLFPHKMGPPKKRALKTLCIENLKRIIQESEAGHDSAEDAEVCIQLIK 983
            |..::|.|:.|:||::|:..   ...|.:||.|..|.|.|.||..|  |||::||...:.::|
Yeast   333 LNVMRLFHNKVIDTAILYSR---TKFKVSLKNLAFEVLSRKIQNGE--HDSSQDAIATMDVVK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12877NP_001034073.1 CDC45 129..>199 CDD:280821
EloA-BP1 572..736 CDD:292495 15/60 (25%)
REX1_like 834..983 CDD:99848 54/151 (36%)
DnaQ 847..>991 CDD:223916 48/140 (34%)
REX3NP_013208.1 REX1_like 244..390 CDD:99848 54/151 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346334
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002085
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103246
Panther 1 1.100 - - O PTHR12801
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2254
SonicParanoid 1 1.000 - - X1541
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.