DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12877 and SDN3

DIOPT Version :9

Sequence 1:NP_001034073.1 Gene:CG12877 / 43333 FlyBaseID:FBgn0039544 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_201525.2 Gene:SDN3 / 836859 AraportID:AT5G67240 Length:782 Species:Arabidopsis thaliana


Alignment Length:191 Identity:60/191 - (31%)
Similarity:95/191 - (49%) Gaps:12/191 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   795 PG-CTYANYHVSDYYDPEKLTCFVKTIERGEEFVPTKKDIYALDCEMCYTTHGIE-LTRVTVVDI 857
            || .|:.:| ..|:|        |..:.:.:..|.....:.::||||.....|.: |.||..||.
plant   115 PGNYTFPSY-AEDWY--------VTELGKKKSKVIKSTRMLSIDCEMVTCEDGSQALVRVGAVDR 170

  Fly   858 NGRSVYDALVKPDNQIVDYNTTYSGITEAMLSNETRTIRDVQAVLMSMFHAKTVLVGHSLESDLK 922
            :.:.|.|..||||..::||.|..:|:|...|...|.::.|:|..|.......|:||||.|.:||:
plant   171 DLKVVLDKFVKPDKPVIDYKTDITGVTAEDLERATLSVADIQKKLRRFLSVGTILVGHGLHNDLQ 235

  Fly   923 ALKLIHDVVVDTSVLFPHKMGPPKKR-ALKTLCIENLKRIIQESEAGHDSAEDAEVCIQLI 982
            .|::.|..|:|||.:|.....|..:| :|..||...|.:.::...|.|:...||...::|:
plant   236 VLRIDHARVIDTSYVFEFVDAPKTQRPSLNNLCKSVLGQEVRMDGAAHNCVHDAAAAMKLV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12877NP_001034073.1 CDC45 129..>199 CDD:280821
EloA-BP1 572..736 CDD:292495
REX1_like 834..983 CDD:99848 52/151 (34%)
DnaQ 847..>991 CDD:223916 47/138 (34%)
SDN3NP_201525.2 REX1_like 146..297 CDD:99848 52/151 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774159at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12801
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.