DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12877 and SDN3

DIOPT Version :10

Sequence 1:NP_001034073.1 Gene:CG12877 / 43333 FlyBaseID:FBgn0039544 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_201525.2 Gene:SDN3 / 836859 AraportID:AT5G67240 Length:782 Species:Arabidopsis thaliana


Alignment Length:191 Identity:60/191 - (31%)
Similarity:95/191 - (49%) Gaps:12/191 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   795 PG-CTYANYHVSDYYDPEKLTCFVKTIERGEEFVPTKKDIYALDCEMCYTTHGIE-LTRVTVVDI 857
            || .|:.:| ..|:|        |..:.:.:..|.....:.::||||.....|.: |.||..||.
plant   115 PGNYTFPSY-AEDWY--------VTELGKKKSKVIKSTRMLSIDCEMVTCEDGSQALVRVGAVDR 170

  Fly   858 NGRSVYDALVKPDNQIVDYNTTYSGITEAMLSNETRTIRDVQAVLMSMFHAKTVLVGHSLESDLK 922
            :.:.|.|..||||..::||.|..:|:|...|...|.::.|:|..|.......|:||||.|.:||:
plant   171 DLKVVLDKFVKPDKPVIDYKTDITGVTAEDLERATLSVADIQKKLRRFLSVGTILVGHGLHNDLQ 235

  Fly   923 ALKLIHDVVVDTSVLFPHKMGPPKKR-ALKTLCIENLKRIIQESEAGHDSAEDAEVCIQLI 982
            .|::.|..|:|||.:|.....|..:| :|..||...|.:.::...|.|:...||...::|:
plant   236 VLRIDHARVIDTSYVFEFVDAPKTQRPSLNNLCKSVLGQEVRMDGAAHNCVHDAAAAMKLV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12877NP_001034073.1 PTZ00121 <128..490 CDD:173412
PRK05035 <458..>583 CDD:481472
EloA-BP1 572..734 CDD:464914
REX1_like 834..983 CDD:99848 52/151 (34%)
SDN3NP_201525.2 REX1_like 146..297 CDD:99848 52/151 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.