DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12877 and AT5G25800

DIOPT Version :9

Sequence 1:NP_001034073.1 Gene:CG12877 / 43333 FlyBaseID:FBgn0039544 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_001331646.1 Gene:AT5G25800 / 832649 AraportID:AT5G25800 Length:569 Species:Arabidopsis thaliana


Alignment Length:309 Identity:111/309 - (35%)
Similarity:157/309 - (50%) Gaps:57/309 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   683 LSSLGN--GEPFDALDAEKAYKMVFDLRLTEEQLVENGYPRPGDKRGSAVIRACRPNRRPNQKER 745
            ||||.:  |.|. ||.|.:...:|.::|..:..|...|      ::...|..:..|....:..|.
plant   104 LSSLKSCCGNPM-ALLALRLVCVVDEMRTIDTILTCKG------RKKKTVTSSVEPPPLVSSPEA 161

  Fly   746 YCSRCGKVFSLDIYEHQSFDMCNYHPKSTGYRRGFTDHQHRCCQQPAGTPGCTYANYHVSDYYDP 810
             |:..||.| :::.:...|.: :|:..|               |:.....|.|:           
plant   162 -CNLMGKSF-VELTKDIPFPV-SYYTLS---------------QKEMEQNGYTF----------- 197

  Fly   811 EKLTCFVKTIERGEEFVPT--------KKDIYALDCEMCYTTHGIELTRVTVVDINGRSVYDALV 867
            |||           |..||        ..:|.|||||||.|..|:||||||:|||.|:.:.|.||
plant   198 EKL-----------ELTPTLPAPSGSCPPEIVALDCEMCITKEGLELTRVTLVDIQGQVLLDKLV 251

  Fly   868 KPDNQIVDYNTTYSGITEAMLSNETRTIRDVQAVLMSMFHAKTVLVGHSLESDLKALKLIHDVVV 932
            .|.|.|.||||.|||||..|:...|.|::|:|...:.:...:|:|||||||:||.:||:.|::|:
plant   252 MPTNPITDYNTRYSGITAVMMEGVTTTLKDIQEEFLKLVFKETILVGHSLENDLLSLKISHNLVI 316

  Fly   933 DTSVLFPHKMGPPKKRALKTLCIENLKRIIQESEAGHDSAEDAEVCIQL 981
            ||:||:.|..|...|..|:.|..:.|.|.|||||:||||||||:..:.|
plant   317 DTAVLYKHPHGRSYKTKLRILAKKFLAREIQESESGHDSAEDAKAAMDL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12877NP_001034073.1 CDC45 129..>199 CDD:280821
EloA-BP1 572..736 CDD:292495 14/54 (26%)
REX1_like 834..983 CDD:99848 78/148 (53%)
DnaQ 847..>991 CDD:223916 69/135 (51%)
AT5G25800NP_001331646.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 158 1.000 Domainoid score I1300
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774159at2759
OrthoFinder 1 1.000 - - FOG0002085
OrthoInspector 1 1.000 - - otm2496
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12801
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.