DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12877 and SDN2

DIOPT Version :9

Sequence 1:NP_001034073.1 Gene:CG12877 / 43333 FlyBaseID:FBgn0039544 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_196173.1 Gene:SDN2 / 830437 AraportID:AT5G05540 Length:466 Species:Arabidopsis thaliana


Alignment Length:198 Identity:66/198 - (33%)
Similarity:101/198 - (51%) Gaps:8/198 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   798 TYANYHVSDYYDPEKLTCFVKTIERGEEFVPTKKDIYALDCEMCYTTHGIE-LTRVTVVDINGRS 861
            |:..|.: ||..|.....:|:|....::..|||.::.|:||||.....|.| :.||..||.:.:.
plant   108 THDEYPL-DYLFPSNAEDWVRTGLGKKKMEPTKIEMIAIDCEMVLCEDGSEAVVRVAAVDRDLKV 171

  Fly   862 VYDALVKPDNQIVDYNTTYSGITEAMLSNETRTIRDVQAVLMSMFHAKTVLVGHSLESDLKALKL 926
            :.|..|||:..:|||.|..:|:|...|...|.::.|:|..|:......|:|||.||..|||.||:
plant   172 ILDEFVKPNQPVVDYRTFITGLTAQDLEKATISVVDIQEKLLMFISEDTILVGQSLNHDLKVLKV 236

  Fly   927 IHDVVVDTSVLFPHKMGPP------KKRALKTLCIENLKRIIQESEAGHDSAEDAEVCIQLIKYY 985
            .|..|:|||::|.:.....      |:.:|..||...|...:|:....|:...|||..::|:...
plant   237 DHARVIDTSLVFKYNYDGTRRPLRLKRPSLNYLCKCILGYEVQKEGVPHNCVHDAEAAMKLVLAI 301

  Fly   986 LRN 988
            |.|
plant   302 LDN 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12877NP_001034073.1 CDC45 129..>199 CDD:280821
EloA-BP1 572..736 CDD:292495
REX1_like 834..983 CDD:99848 54/155 (35%)
DnaQ 847..>991 CDD:223916 50/149 (34%)
SDN2NP_196173.1 REX1_like 143..299 CDD:99848 54/155 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774159at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12801
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.