DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12877 and AT3G50090

DIOPT Version :9

Sequence 1:NP_001034073.1 Gene:CG12877 / 43333 FlyBaseID:FBgn0039544 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_190578.1 Gene:AT3G50090 / 824171 AraportID:AT3G50090 Length:322 Species:Arabidopsis thaliana


Alignment Length:191 Identity:51/191 - (26%)
Similarity:84/191 - (43%) Gaps:15/191 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   802 YHVSDYYDPEKLTCFVKTIERGEEFVPTKKDIYALDCEMCYTTHGIE-LTRVTVVDINGRSVYDA 865
            |:|...:.......||..:......|.....:.||||||.....|.| :.||..||.|.:.:.|.
plant    44 YNVDFLFHSYSKDWFVSDVGMKMSNVMIPNQMLALDCEMVLCEDGTEGVVRVGAVDRNLKVILDE 108

  Fly   866 LVKPDNQIVDYNTTYSGITEAMLSNETRTIRDVQAVLMSMFHAKTVLVGHSLESDLKALKLIHDV 930
            .|||...:|||.|..:|:|...:...|.::.|:|..|.....|..:|:.             |.:
plant   109 FVKPHKPVVDYRTAITGVTAEDVQKATLSLVDIQEKLRPFLSAGAILID-------------HPI 160

  Fly   931 VVDTSVLFPHKMGPPKKR-ALKTLCIENLKRIIQESEAGHDSAEDAEVCIQLIKYYLRNKI 990
            |:|||::|.:......:| :|.|||:..|...:|::...|....||...::|....::.::
plant   161 VIDTSLVFKYPNSRKLRRPSLNTLCMSVLGYEVQKAGVSHHCVHDAAAAMKLALAVIKKRV 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12877NP_001034073.1 CDC45 129..>199 CDD:280821
EloA-BP1 572..736 CDD:292495
REX1_like 834..983 CDD:99848 46/150 (31%)
DnaQ 847..>991 CDD:223916 39/146 (27%)
AT3G50090NP_190578.1 DnaQ_like_exo 76..205 CDD:299142 43/141 (30%)
RRM_SF 236..300 CDD:240668
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.