DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12877 and Aen

DIOPT Version :9

Sequence 1:NP_001034073.1 Gene:CG12877 / 43333 FlyBaseID:FBgn0039544 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_001347638.1 Gene:Aen / 68048 MGIID:1915298 Length:336 Species:Mus musculus


Alignment Length:177 Identity:59/177 - (33%)
Similarity:91/177 - (51%) Gaps:14/177 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   815 CFVKTIERGEEFVPTKKDIYALDCEMCYT-THG--IELTRVTVVDINGRSVYDALVKPDNQIVDY 876
            |..|::.| |...|......|:||||..| ..|  .||.|.:||..:|..:||..::|:..||||
Mouse    92 CSKKSVPR-EAPRPGPIKCVAIDCEMVGTGPQGRVSELARCSVVSYSGDVLYDKYIRPEMPIVDY 155

  Fly   877 NTTYSGITEAMLSNETRTIRDVQAVLMSMFHAKTVLVGHSLESDLKALKLIH--DVVVDTSVLFP 939
            .|.:||||...: ::....:..|..::.:...| |:|||:|.:|.:|||.:|  ....||:.: |
Mouse   156 RTRWSGITRQHM-HKAIPFQVAQKEILKLLKGK-VVVGHALHNDFQALKYVHPRSQTRDTTYV-P 217

  Fly   940 HKMGPPK-----KRALKTLCIENLKRIIQESEAGHDSAEDAEVCIQL 981
            :.:..|.     :.:||.|.:..|.:.||....||.|.|||...::|
Mouse   218 NLLSQPSSLIRTRVSLKDLALNLLHKKIQVGHQGHSSVEDAMTAMEL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12877NP_001034073.1 CDC45 129..>199 CDD:280821
EloA-BP1 572..736 CDD:292495
REX1_like 834..983 CDD:99848 54/158 (34%)
DnaQ 847..>991 CDD:223916 47/142 (33%)
AenNP_001347638.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
Nucleolar localization signal. /evidence=ECO:0000250 25..33
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..102 4/10 (40%)
DnaQ_like_exo 110..266 CDD:324557 54/158 (34%)
Nuclear localization signal. /evidence=ECO:0000250 164..187 1/23 (4%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..336
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845406
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.