DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12877 and AEN

DIOPT Version :9

Sequence 1:NP_001034073.1 Gene:CG12877 / 43333 FlyBaseID:FBgn0039544 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_073604.3 Gene:AEN / 64782 HGNCID:25722 Length:325 Species:Homo sapiens


Alignment Length:267 Identity:67/267 - (25%)
Similarity:113/267 - (42%) Gaps:46/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   735 RPNRRPNQKERYCSRCGKVFSLDIYEHQSFDMCNYHPKSTGYRRGF--------TDHQHRCCQQP 791
            |..||..|.:|:.:|..      :.:.|........|.|:.....|        .....:|.:..
Human    29 RHKRRSRQHQRFMARKA------LLQEQGLLSMPPEPGSSPLPTPFGAATATEAASSGKQCLRAG 87

  Fly   792 AGTPGCTYANYHVSDYYDPEKLTCFVKTIERGEEFVPTKKDIYALDCEMCYT-THG--IELTRVT 853
            :|:..|:                   :....|:...|......|:||||..| ..|  .||.|.:
Human    88 SGSAPCS-------------------RRPAPGKASGPLPSKCVAIDCEMVGTGPRGRVSELARCS 133

  Fly   854 VVDINGRSVYDALVKPDNQIVDYNTTYSGITEAMLSNETRTIRDVQAVLMSMFHAKTVLVGHSLE 918
            :|..:|..:||..::|:..|.||.|.:||||...: .:....:..|..::.:...| |:|||:|.
Human   134 IVSYHGNVLYDKYIRPEMPIADYRTRWSGITRQHM-RKAVPFQVAQKEILKLLKGK-VVVGHALH 196

  Fly   919 SDLKALKLIH--DVVVDTSVLFPHKMGPP-----KKRALKTLCIENLKRIIQESEAGHDSAEDAE 976
            :|.:|||.:|  ....||:.: |:.:..|     .:.:||.|.::.|.:.||..:.||.|.|||.
Human   197 NDFQALKYVHPRSQTRDTTYV-PNFLSEPGLHTRARVSLKDLALQLLHKKIQVGQHGHSSVEDAT 260

  Fly   977 VCIQLIK 983
            ..::|.:
Human   261 TAMELYR 267

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG12877NP_001034073.1 CDC45 129..>199 CDD:280821