DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12877 and Eqtn

DIOPT Version :9

Sequence 1:NP_001034073.1 Gene:CG12877 / 43333 FlyBaseID:FBgn0039544 Length:991 Species:Drosophila melanogaster
Sequence 2:XP_038966505.1 Gene:Eqtn / 500502 RGDID:1563332 Length:308 Species:Rattus norvegicus


Alignment Length:276 Identity:47/276 - (17%)
Similarity:92/276 - (33%) Gaps:71/276 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 EPEADKDTEAAVL---------TPAEP-----MDDLDDMDF---DFEADTSEGEIVRQCEMIFDE 372
            |.|.:.|..:|:.         |||..     ..|:....|   |.:...:|..:....::.|  
  Rat    40 EEENNTDENSAIFQKLEDNGGDTPANEKTGNYYKDIKQYVFTTPDSKGTKTEVSVTATTDLKF-- 102

  Fly   373 MEKKFAQMHKDEGGNANPESSRKRKAPSPDIDTFTEAATAALQKRRVAHENADKITPHLAPSAAM 437
            ..|.:........|..:..|...||:.:|::..|......|:.:..|:.::.| :.....|::.:
  Rat   103 TMKDYKSSKATASGEEDKRSEPSRKSSTPNVPAFWTMLAKAINETAVSMDDKD-LFYQAIPASDL 166

  Fly   438 RKPNHVRNAMQAIFNRRAELRRQEKLQAE---------------------ASAEQVRQAQERVRQ 481
            ...|            ..:|...|:::.:                     |:..::|..:::..:
  Rat   167 NSTN------------EDQLSELEEIKLKLMLGISLMTLILLIPLLIFCFATLYKLRHLRDKTCE 219

  Fly   482 AQEELR---------QAKVNSNLTPLISRSALTPPVRSARSIAPVANIVAIARAKKKIEELQAEK 537
            :|..:.         .....||.|.|...|:..||..|.:.:...:|.|..|..   .||..:|:
  Rat   220 SQYSVNPELATLSYFHPSEGSNQTVLTEESSFLPPEESGKVVIIESNTVNEAEV---TEERISER 281

  Fly   538 KPAFTPAQSFKGAGRV 553
            :      ..|.|.|.|
  Rat   282 R------NCFAGGGCV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12877NP_001034073.1 CDC45 129..>199 CDD:280821
EloA-BP1 572..736 CDD:292495
REX1_like 834..983 CDD:99848
DnaQ 847..>991 CDD:223916
EqtnXP_038966505.1 Afaf 63..250 CDD:405924 28/201 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.