Sequence 1: | NP_001034073.1 | Gene: | CG12877 / 43333 | FlyBaseID: | FBgn0039544 | Length: | 991 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011240147.1 | Gene: | Rexo5 / 434234 | MGIID: | 1919402 | Length: | 858 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 70/196 - (35%) |
---|---|---|---|
Similarity: | 112/196 - (57%) | Gaps: | 21/196 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 793 GTPGCTYANYHVSDYYDPEKLTCFVKTIERGEEFVPTKKDIYALDCEMCYTTHGIELTRVTVVDI 857
Fly 858 NGRSVYDALVKPDNQIVDYNTTYSGITEAMLSNETRTIRDVQAVLMSMFHAKTVLVGHSLESDLK 922
Fly 923 ALKLIHDVVVDTSVLFPHKMGPPKKRALKTLCIENLKRIIQ-ESEAGHDSAEDAEVCIQLIKYYL 986
Fly 987 R 987 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12877 | NP_001034073.1 | CDC45 | 129..>199 | CDD:280821 | |
EloA-BP1 | 572..736 | CDD:292495 | |||
REX1_like | 834..983 | CDD:99848 | 62/149 (42%) | ||
DnaQ | 847..>991 | CDD:223916 | 57/142 (40%) | ||
Rexo5 | XP_011240147.1 | REX1_like | 225..373 | CDD:99848 | 62/149 (42%) |
RRM_SF | 490..560 | CDD:388407 | |||
RRM_SF | 586..656 | CDD:388407 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167845404 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0847 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.740 |