DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12877 and Rexo5

DIOPT Version :9

Sequence 1:NP_001034073.1 Gene:CG12877 / 43333 FlyBaseID:FBgn0039544 Length:991 Species:Drosophila melanogaster
Sequence 2:XP_011240147.1 Gene:Rexo5 / 434234 MGIID:1919402 Length:858 Species:Mus musculus


Alignment Length:196 Identity:70/196 - (35%)
Similarity:112/196 - (57%) Gaps:21/196 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   793 GTPGCTYANYHVSDYYDPEKLTCFVKTIERGEEFVPTKKDIYALDCEMCYTTHGIELTRVTVVDI 857
            |:|  .|.|:.::.|                ..|:.....::.||||:|.|:.|.||||:::|..
Mouse   202 GSP--NYENFILTKY----------------TGFITDSSPLFGLDCEVCLTSMGKELTRISLVTE 248

  Fly   858 NGRSVYDALVKPDNQIVDYNTTYSGITEAMLSNETRTIRDVQAVLMSMFHAKTVLVGHSLESDLK 922
            .|..:.|.|||||.:|:||.|:::|||:.:|:..|..::|||.:|..:.....|||||.|:.||:
Mouse   249 GGYCLIDELVKPDLKILDYLTSFTGITKEILNPVTTKLKDVQKLLRELLPPDAVLVGHCLDLDLR 313

  Fly   923 ALKLIHDVVVDTSVLFPHKMGPPKKRALKTLCIENLKRIIQ-ESEAGHDSAEDAEVCIQLIKYYL 986
            .||:||..|:|||:|:..|.|  ::..|..|....|.:.|| .::.|.|..|||...::|::|:|
Mouse   314 VLKMIHPYVIDTSLLYAGKQG--RRFKLTFLARVILGKDIQCPNKLGRDGIEDARAALELLQYFL 376

  Fly   987 R 987
            :
Mouse   377 K 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12877NP_001034073.1 CDC45 129..>199 CDD:280821
EloA-BP1 572..736 CDD:292495
REX1_like 834..983 CDD:99848 62/149 (42%)
DnaQ 847..>991 CDD:223916 57/142 (40%)
Rexo5XP_011240147.1 REX1_like 225..373 CDD:99848 62/149 (42%)
RRM_SF 490..560 CDD:388407
RRM_SF 586..656 CDD:388407
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845404
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.