DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12877 and CG6833

DIOPT Version :10

Sequence 1:NP_001034073.1 Gene:CG12877 / 43333 FlyBaseID:FBgn0039544 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_648689.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster


Alignment Length:183 Identity:60/183 - (32%)
Similarity:83/183 - (45%) Gaps:42/183 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   833 IYALDCEMCYTTHGIE---LTRVTVVDINGRSVYDALVKPDNQIVDYNTTYSGITEAMLSNETRT 894
            |.|:||||....|...   |.||::|:..|..:.|..|||..::.||.|:.|||....::| ...
  Fly   117 ILAMDCEMVGVGHNTRDDMLARVSIVNRMGHVLLDKYVKPRKEVTDYRTSVSGIRPQDIAN-GED 180

  Fly   895 IRDVQAVLMSMFHAKTVLVGHSLESDLKALKL---IHDVVVDTSVLFPHKMGPPKKRALKTLC-- 954
            ...||..:|.:.|.: :||||.|.:||..|.:   .|| :.|||    |         .|.||  
  Fly   181 FAAVQNEVMKLIHGR-ILVGHGLRNDLAVLGIRHPFHD-IRDTS----H---------YKPLCKL 230

  Fly   955 IEN-----LKRII-----QESEAG-HDSAEDAEVCIQLI-------KYYLRNK 989
            |.|     |||:.     ||.:.| |:|.|||...:.:.       :.||..|
  Fly   231 ISNTHTPSLKRLTKAVLGQEIQTGEHNSVEDARAAMGIYNRVAVDWEKYLEKK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12877NP_001034073.1 PTZ00121 <128..490 CDD:173412
PRK05035 <458..>583 CDD:481472
EloA-BP1 572..734 CDD:464914
REX1_like 834..983 CDD:99848 56/174 (32%)
CG6833NP_648689.1 REX4_like 118..270 CDD:99847 56/167 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.