DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12877 and ISG20

DIOPT Version :10

Sequence 1:NP_001034073.1 Gene:CG12877 / 43333 FlyBaseID:FBgn0039544 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_002192.2 Gene:ISG20 / 3669 HGNCID:6130 Length:181 Species:Homo sapiens


Alignment Length:170 Identity:50/170 - (29%)
Similarity:85/170 - (50%) Gaps:16/170 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   831 KDIYALDCEMC----YTTHGIELTRVTVVDINGRSVYDALVKPDNQIVDYNTTYSGITEAMLSNE 891
            :::.|:||||.    :...|  |.|.::|:::|..:||..::|:.:|.||.|..||:|...:...
Human     5 REVVAMDCEMVGLGPHRESG--LARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGA 67

  Fly   892 TRTIRDVQAVLMSMFHAKTVLVGHSLESDLKALK------LIHDVVVDTSVLFPHKMGPPKKRAL 950
            | .....:..::.:...|.| |||.|:.|.:|||      .|:|...|..:....|:...::.:|
Human    68 T-PFAVARLEILQLLKGKLV-VGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSL 130

  Fly   951 KTLCIENLKRIIQESEAGHDSAEDAEVCIQLIKYYLRNKI 990
            :.|....|.:.||.|..||.|.|||...::|  |.:..:|
Human   131 RVLSERLLHKSIQNSLLGHSSVEDARATMEL--YQISQRI 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12877NP_001034073.1 PTZ00121 <128..490 CDD:173412
PRK05035 <458..>583 CDD:481472
EloA-BP1 572..734 CDD:464914
REX1_like 834..983 CDD:99848 48/158 (30%)
ISG20NP_002192.2 DnaQ_like_exo 8..163 CDD:447876 48/160 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.