DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12877 and Rexo4

DIOPT Version :9

Sequence 1:NP_001034073.1 Gene:CG12877 / 43333 FlyBaseID:FBgn0039544 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_001029056.1 Gene:Rexo4 / 311826 RGDID:1306220 Length:409 Species:Rattus norvegicus


Alignment Length:381 Identity:89/381 - (23%)
Similarity:142/381 - (37%) Gaps:99/381 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   637 AINKLRKEALEAGNKPSVA--CKTVSHEMMLGGKRALTTSWSVEKKGKLSSLGNGEPFDALDAEK 699
            |:.:|.|...||..||.::  ...:.|::             ::|..|.:|          |..|
  Rat    63 ALQELLKRKSEAPEKPRISQLDDKIHHQI-------------IQKNRKKTS----------DKSK 104

  Fly   700 AYKMVFDLRLTEEQLVENGYPRPGDKRGSAVIRACRPNRRPNQKERYCSRCGKVFSLDIYEHQSF 764
            ..|...|.:.|.:.:  ...|:...|.......|....::...::|..|        |:..||. 
  Rat   105 GDKRTEDDKPTRDSV--TSAPKKVRKTPVPPTNASGTEQKKGAEKRTRS--------DLSSHQG- 158

  Fly   765 DMCNYHPKSTGYRRGFTDHQHR--------CCQQPAGTPGCTYANYHVSDYYDPEKLTCFV---- 817
                             |.:|:        ...||..|....:     .|..||:.:...|    
  Rat   159 -----------------DIKHKGKAKEAAVILSQPTPTEEDIW-----FDDVDPDDIEAAVGPEA 201

  Fly   818 -----KTIERGEEFVPTKKD--------IYALDCEMC-YTTHGIE--LTRVTVVDINGRSVYDAL 866
                 |.:.:....:...|:        ..||||||. ....|.|  ..||::|:..|:.|||..
  Rat   202 AMLVRKRLGQRTSTISLVKEQAFGGLTKALALDCEMVGVGPKGEESIAARVSIVNQYGKCVYDKY 266

  Fly   867 VKPDNQIVDYNTTYSGITEAML--SNETRTI-RDVQAVLMSMFHAKTVLVGHSLESDLKALKLIH 928
            |||...:.||.|..|||....|  ..|...: ::|.|:|..     .:||||:|.:|||.|.|.|
  Rat   267 VKPTEPVTDYRTAVSGIRPENLKQGEEFEVVKKEVAAMLKG-----RILVGHALRNDLKVLFLEH 326

  Fly   929 --DVVVDTSVLFPHK-MGPPKKRALKTLCIENLKRIIQESEAGHDSAEDAEVCIQL 981
              ..:.||....|.: :....:.:||.|..:.|...:|::|  |.|.:||:..::|
  Rat   327 PKKKIRDTQKFKPFRSLVKSARPSLKQLSEKILGLRVQQAE--HCSVQDAQAAMRL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12877NP_001034073.1 CDC45 129..>199 CDD:280821
EloA-BP1 572..736 CDD:292495 19/100 (19%)
REX1_like 834..983 CDD:99848 54/157 (34%)
DnaQ 847..>991 CDD:223916 47/143 (33%)
Rexo4NP_001029056.1 DnaQ 228..>392 CDD:223916 54/160 (34%)
REX4_like 231..381 CDD:99847 54/157 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.