DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12877 and Rexo5

DIOPT Version :9

Sequence 1:NP_001034073.1 Gene:CG12877 / 43333 FlyBaseID:FBgn0039544 Length:991 Species:Drosophila melanogaster
Sequence 2:XP_038934563.1 Gene:Rexo5 / 309036 RGDID:1305412 Length:846 Species:Rattus norvegicus


Alignment Length:196 Identity:72/196 - (36%)
Similarity:112/196 - (57%) Gaps:21/196 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   793 GTPGCTYANYHVSDYYDPEKLTCFVKTIERGEEFVPTKKDIYALDCEMCYTTHGIELTRVTVVDI 857
            |:|.|  .|:.:..|                ..|:.....::.||||:|.|:.|.||||:::|..
  Rat   200 GSPNC--ENFILLKY----------------SGFITDSSPLFGLDCEVCLTSMGKELTRISLVAE 246

  Fly   858 NGRSVYDALVKPDNQIVDYNTTYSGITEAMLSNETRTIRDVQAVLMSMFHAKTVLVGHSLESDLK 922
            .|..:.|.|||||.:|:||.|::||||:.:|:..|..::|||.:|..:.....|||||.|:.||:
  Rat   247 GGYCLMDELVKPDFKILDYLTSFSGITKEILNPVTTKLKDVQKLLRELLPPDAVLVGHCLDLDLR 311

  Fly   923 ALKLIHDVVVDTSVLFPHKMGPPKKRALKTLCIENLKRIIQ-ESEAGHDSAEDAEVCIQLIKYYL 986
            .||:||..|:|||:|:..|.|  ::..|..|....|.:.|| .::.|||..|||...::|::|:|
  Rat   312 VLKIIHPYVIDTSLLYIGKQG--RRFKLTFLAKVILGKDIQCPNKLGHDGIEDARTALELVQYFL 374

  Fly   987 R 987
            :
  Rat   375 K 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12877NP_001034073.1 CDC45 129..>199 CDD:280821
EloA-BP1 572..736 CDD:292495
REX1_like 834..983 CDD:99848 64/149 (43%)
DnaQ 847..>991 CDD:223916 59/142 (42%)
Rexo5XP_038934563.1 REX1_like 223..371 CDD:99848 64/149 (43%)
RRM_SF 508..578 CDD:418427
RRM_SF 604..674 CDD:418427
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348814
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.