DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12877 and SPAC637.09

DIOPT Version :9

Sequence 1:NP_001034073.1 Gene:CG12877 / 43333 FlyBaseID:FBgn0039544 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_594627.2 Gene:SPAC637.09 / 2543505 PomBaseID:SPAC637.09 Length:631 Species:Schizosaccharomyces pombe


Alignment Length:186 Identity:80/186 - (43%)
Similarity:109/186 - (58%) Gaps:16/186 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   819 TIERGEEFV---------------PTKKDIYALDCEMCYTTHGIELTRVTVVDINGRSVYDALVK 868
            |:.:|||..               |....|.|:||||..|.:|:|:.|||:||:....:||..||
pombe   247 TVMKGEEVTQPSGWVASAGDFHSPPINPKILAIDCEMVRTENGLEIARVTIVDMKSEVIYDEFVK 311

  Fly   869 PDNQIVDYNTTYSGITEAMLSNETRTIRDVQAVLMSMFHAKTVLVGHSLESDLKALKLIHDVVVD 933
            |::.:.||.|.||||||..|.|.|..:.|||:.|.......|||:||||.|||..||..|..::|
pombe   312 PESPVTDYVTQYSGITEEKLRNVTTVLSDVQSYLKKTVDNNTVLLGHSLNSDLNCLKFTHPHIID 376

  Fly   934 TSVLFPHKMGPPKKRALKTLCIENLKRIIQESEA-GHDSAEDAEVCIQLIKYYLRN 988
            |:.::.|..|||.|.:||.|..:.|:|.||::.| ||||||||..|:.|:|..::|
pombe   377 TANIYNHTRGPPSKPSLKWLATKWLRREIQKAGALGHDSAEDALACVDLLKLKVKN 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12877NP_001034073.1 CDC45 129..>199 CDD:280821
EloA-BP1 572..736 CDD:292495
REX1_like 834..983 CDD:99848 72/149 (48%)
DnaQ 847..>991 CDD:223916 67/143 (47%)
SPAC637.09NP_594627.2 DnaQ 272..532 CDD:223916 75/161 (47%)
REX1_like 277..427 CDD:99848 72/149 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1173
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47103
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12801
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2254
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.