DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG12877 and Trex1

DIOPT Version :9

Sequence 1:	NP_001034073.1	Gene:	CG12877 / 43333	FlyBaseID:	FBgn0039544	Length:	991	Species:	Drosophila melanogaster
Sequence 2:	NP_001012236.1	Gene:	Trex1 / 22040	MGIID:	1328317	Length:	314	Species:	Mus musculus

Alignment Length:	105	Identity:	23/105 - (21%)
Similarity:	36/105 - (34%)	Gaps:	31/105 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly    33 HARKDELEAAPPAEPSPVPKYKPAPKLLSLPLPQITLC-APRKKSNLEYHPEKPALDASPAKKKQ 96
            |.|..|..:.....|.|||:   .|:::.    :::|| ||.|..:       |.........|.
Mouse    40 HRRALENTSISQGHPPPVPR---PPRVVD----KLSLCIAPGKACS-------PGASEITGLSKA 90

  Fly    97 EASVDSAPK-----------YVPGQPS-----VTNGEEYD 120
            |..|....:           ::..||.     ..||:.||
Mouse    91 ELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYD 130

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG12877	NP_001034073.1	CDC45	129..>199	CDD:280821
		EloA-BP1	572..736	CDD:292495
		REX1_like	834..983	CDD:99848
		DnaQ	847..>991	CDD:223916
Trex1	NP_001012236.1	DnaQ	13..>204	CDD:223916	23/105 (22%)
		TREX1_2	14..211	CDD:99839	23/105 (22%)
		Substrate binding	20..21
		Proline-rich region	54..63		5/11 (45%)
		Necessary for endoplasmic reticulum localization	236..314
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	237..284
		Interaction with UBQLN1. /evidence=ECO:0000250	244..314
		Necessary for cytoplasmic retention	281..314
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0847
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900